Recombinant Pongo abelii FtsJ methyltransferase domain-containing protein 1 (FTSJD1)

Shipped with Ice Packs
In Stock

Description

Table 1: Key Molecular Attributes

PropertyDescriptionSource
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cells
Purity≥85% (SDS-PAGE verified)
Methylation SpecificityCap2 methylation (second nucleotide); enhanced by prior cap1 methylation

Recombinant Production and Purification

Recombinant Pongo abelii FTSJD1 is produced using multiple expression systems:

  • Cell-Free Expression: Yields partial or full-length protein with ≥85% purity .

  • Mammalian Systems: Used for post-translational modifications mimicking native enzymatic activity .

Table 2: Production Parameters

ParameterDetail
Expression TagHis-tag (optional)
SolubilityCytosolic and nuclear fractions
Activity ValidationMethyltransferase assays using S-adenosylmethionine (SAM) as co-factor

Role in RNA Modification

  • Cap2 Methylation: Essential for stabilizing mRNA and enhancing translation efficiency .

  • Interdependence: Requires prior N7-methylation of the guanosine cap for optimal activity .

Pathological Implications

  • Cancer: Homologs like human FTSJ1 are implicated in triple-negative breast cancer (TNBC) progression by suppressing CD8+ T-cell infiltration .

  • Neurological Disorders: Mutations in FTSJ1 cause X-linked intellectual disability (XLID) via tRNA modification defects .

Key Research Findings:

  • Loss of FTSJ1 in mice reduces tRNA<sup>Phe</sup> levels, impairing synaptic plasticity and memory .

  • FTSJD1 knockdown in TNBC cells inhibits proliferation and enhances T-cell cytotoxicity .

Applications in Biotechnology and Medicine

  • RNA Research: Tool for studying cap-dependent translation mechanisms .

  • Therapeutic Development: Target for cancer immunotherapy and neurological disorder treatments .

  • Diagnostics: Antibodies against FTSJD1 are used in immunohistochemistry and Western blotting .

Table 3: Cross-Species Comparison of FTSJD1

SpeciesGene NameMethylation TargetsPathological Role
Pongo abeliiFTSJD1mRNA (cap2), snRNAUnder investigation
Homo sapiensCMTR2mRNA (cap2), tRNA<sup>Phe</sup>Cancer, intellectual disability
Mus musculusFtsjd1tRNA<sup>Phe</sup>, tRNA<sup>Trp</sup>Synaptic dysfunction

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
CMTR2; FTSJD1; Cap-specific mRNA; nucleoside-2'-O--methyltransferase 2; Cap methyltransferase 2; Cap2 2'O-ribose methyltransferase 2; MTr2; FtsJ methyltransferase domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-769
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
CMTR2
Target Protein Sequence
MSKCRKTPVQQLASPTSFSPDILADIFELFAKNFSYSKPLNNEWQLPDPSEIFTCDHTEF NAFLDLKNSLNEVKNLLSDKKLDEWHEHTAFTNKAGKIISHVRKSVNAELCTQAWCKFHE ILCSFPLIPQEAFQNGKLNSLHLCEAPGAFIASLNHYLKSHRFPCHWSWVANTLNPYHEA NDDLMMIMDDRLIANTLHWWYFGPDNTGDIMTLKFLTGLQNFISSMATVHLVTADGSFDC QGNPGEQEALVSSLHYCEVVTALTTLGNGGSFVLKMFTMFEHCSINLMYLLNCCLDQVHV FKPATSKAGNSEVYVVCLYYKGREAIHPLLSKMTLNFGTEMKRKALFPHHVIPDSFLKRH EECCVFFHKYQLETISENIRLFECMGKAEQEKLNNLRDCAVQYFMQKFQLKHLSRNNWLV KKSSIGCSTNTKWFGQRNKYFRTYNERKMLEALSWKDKVAKGYFNSWAEEHGVYHPGQSS ILEGTASNLECHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPK QQYSCSCHVFSEELIFSELCSLTECLQDEQVVEPSNRIKCLLVGFSTLHNIKMHIPLEVR LLESAELTTFSCSLLHDGDPTYQRLFLDCLLHSLRELHTGDVMILPVLSCFTRFMAGLIF VLHSCFRFITFFCPTSSDPLRTCAVLLCVGYQDLPNPVFQYLQSVNELLSTLLNSDSPQQ VLQFVPMEVLLKGALLDFLWDLNAAIAKRHLHFIIQREREEINSLQLQN
Uniprot No.

Target Background

Function

Recombinant Pongo abelii FtsJ methyltransferase domain-containing protein 1 (FTSJD1) is an S-adenosyl-L-methionine-dependent methyltransferase. It mediates mRNA cap2 2'-O-ribose methylation of the 5'-cap structure of mRNAs. Specifically, it methylates the ribose of the second nucleotide of a m(7)GpppG-capped mRNA and small nuclear RNA (snRNA) (cap0) to produce m(7)GpppRmpNm (cap2). This enzyme recognizes a guanosine cap on RNA regardless of its N(7) methylation status, exhibiting cap2 methylation activity on both cap0 and cap1 structures. It demonstrates a preference for cap1 RNAs.

Database Links

KEGG: pon:100172540

UniGene: Pab.12511

Subcellular Location
Nucleus. Cytoplasm.

Q&A

What is FTSJD1 and what is its predicted role in Pongo abelii cellular biology?

FTSJD1 is a methyltransferase domain-containing protein found in Pongo abelii (Sumatran orangutan) that likely plays a role in RNA modification processes. The FtsJ methyltransferase domain typically catalyzes 2'-O-ribose methylation of RNA substrates, contributing to post-transcriptional regulation of gene expression. Based on comparative analysis with similar proteins, FTSJD1 likely modifies specific RNA targets including rRNAs or tRNAs, affecting their stability, structure, and interaction capabilities. The protein is evolutionarily conserved across primates, suggesting functional importance in basic cellular processes such as protein synthesis and RNA metabolism .

Functional studies of FTSJD1 typically require recombinant protein expression systems, with researchers applying RNA-binding assays and methylation activity measurements to characterize its biochemical properties. Current research indicates FTSJD1 may participate in critical RNA processing pathways that influence cell development and response to environmental stressors. The structural characterization of this protein continues to reveal important insights about RNA methylation mechanisms across species.

What expression systems have proven most effective for producing functional recombinant FTSJD1?

Multiple expression systems have been evaluated for producing recombinant Pongo abelii proteins, with varying success depending on research requirements. For FTSJD1 specifically, E. coli expression systems have provided reasonable yields for initial biochemical characterization, though with limitations in post-translational modifications. The expression protocol typically involves gene cloning into appropriate vectors followed by transformation into competent cells, with optimization of induction conditions to maximize protein folding and solubility .

Yeast expression systems offer an alternative approach that can better accommodate eukaryotic protein folding requirements. According to available data, Pongo abelii recombinant proteins have been successfully expressed in yeast with N-terminal tags to facilitate purification and detection . For optimal expression, researchers should consider using codon-optimized sequences aligned with the expression host's preferences. Expression region selection is critical, with documented success using regions spanning amino acids 527-637 for some Pongo abelii proteins, though this must be specifically optimized for FTSJD1 .

The addition of affinity tags significantly improves purification efficiency, with documented success using N-terminal 10xHis-tags and C-terminal Myc-tags for Pongo abelii recombinants . Temperature, induction time, and media composition represent critical variables requiring optimization to enhance soluble protein yield while minimizing inclusion body formation.

What purification strategies yield the highest purity of functional FTSJD1?

Purification of recombinant FTSJD1 typically follows a multi-step chromatography approach to achieve research-grade purity. Based on protocols established for similar Pongo abelii recombinant proteins, initial capture via immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag provides effective enrichment. This approach has demonstrated purity levels exceeding 85% as determined by SDS-PAGE analysis for similar Pongo abelii recombinant proteins .

Further purification often requires size exclusion chromatography to remove aggregates and degradation products, followed by ion exchange chromatography for removing contaminants with different charge properties. For functional studies, researchers must verify that the purification process preserves methyltransferase activity, typically through activity assays using model RNA substrates and radiolabeled methyl donors.

The molecular weight of FTSJD1 (approximately 19.8 kDa for the core domain) influences purification strategy design, particularly regarding column selection and elution conditions . Buffer optimization represents a critical step, with stability assessments required across various pH and salt concentrations. Researchers typically employ dynamic light scattering or analytical ultracentrifugation to confirm monodispersity of the purified protein prior to functional or structural studies.

What quasi-experimental approaches are most appropriate for studying FTSJD1 function in cell culture models?

Quasi-experimental approaches offer valuable frameworks for investigating FTSJD1 function when randomized controlled experiments prove challenging. Based on established methodological hierarchies, several designs are particularly suitable for FTSJD1 research in cellular models . The one-group pretest-posttest design (O1 X O2) enables researchers to measure RNA methylation patterns before and after FTSJD1 manipulation, providing preliminary evidence of its functional impact .

More robust evidence emerges from designs incorporating control groups and multiple measurement timepoints. The untreated control group design with dependent pretest and posttest samples (Intervention group: O1a X O2a; Control group: O1b O2b) allows researchers to compare FTSJD1-manipulated cells against controls, controlling for time-dependent effects unrelated to the experimental intervention . For studying the reversibility of FTSJD1-mediated RNA modifications, the removed-treatment design (O1 X O2 O3 removeX O4) offers particular advantages, enabling assessment of both methylation induction and reversion phases .

The interrupted time-series design represents the most sophisticated approach, involving multiple measurements before and after FTSJD1 manipulation (O1 O2 O3 O4 O5 X O6 O7 O8 O9 O10). This design enables detection of both immediate and delayed effects while providing robust controls for pre-existing trends . When designing these studies, researchers must carefully consider appropriate control conditions, measurement timing, and potential confounding variables to strengthen causal inferences about FTSJD1 function.

How can genome editing technologies be optimized for studying FTSJD1 function?

Genome editing technologies offer powerful approaches for investigating FTSJD1 function through precise genetic manipulation. TAL effector nucleases (TALENs) provide one established method, utilizing customizable DNA-binding domains fused to FokI nuclease to introduce targeted modifications at the FTSJD1 locus . The design process requires identification of appropriate target sequences within the FTSJD1 gene, followed by construction of TAL effector arrays with specific amino acid repeats corresponding to the target sequence .

The plasmid-based system described in recent literature enables efficient assembly of custom TALEN constructs targeting specific regions of interest in the FTSJD1 gene . This approach has demonstrated successful gene editing in both human cells and plant protoplasts, suggesting broad applicability across model systems . The method's versatility allows researchers to generate various genetic modifications including complete knockouts, specific point mutations, or insertion of reporter tags.

Several design considerations prove critical for successful application. Target site selection must account for chromatin accessibility and potential off-target effects. Validation strategies should include sequencing of modified regions and functional assessment of FTSJD1 expression or activity. Beyond TALENs, researchers should consider alternative approaches including CRISPR-Cas systems, which may offer advantages in efficiency and multiplexing capabilities. These genome editing approaches enable researchers to establish causal relationships between FTSJD1 genotype and cellular phenotypes.

What assays most effectively characterize FTSJD1 methyltransferase activity?

Characterization of FTSJD1 methyltransferase activity requires sensitive and specific biochemical assays that detect RNA modification. The most direct approach involves measuring the transfer of methyl groups from S-adenosylmethionine (SAM) to RNA substrates using radiolabeled [3H]-SAM or [14C]-SAM. This method provides quantitative data on methylation rates and can be adapted to study substrate specificity and enzyme kinetics.

For detection of FTSJD1 binding to potential RNA substrates prior to methylation, functional ELISA-based approaches have proven effective for similar recombinant proteins . These binding assays can be complemented with biophysical methods including surface plasmon resonance or isothermal titration calorimetry to determine binding affinities and thermodynamic parameters. Mass spectrometry represents another powerful approach, enabling precise identification of methylation sites within RNA substrates.

Cell-based assays provide complementary information about FTSJD1 function in a more physiological context. These typically involve expression of wild-type or mutant FTSJD1 in cellular models, followed by transcriptome-wide assessment of RNA methylation patterns using techniques such as methylated RNA immunoprecipitation sequencing (MeRIP-seq). Integration of biochemical and cellular approaches provides the most comprehensive characterization of FTSJD1 methyltransferase activity and substrate specificity.

How does FTSJD1 from Pongo abelii compare with homologous proteins from other species?

Comparative analysis of FTSJD1 across species provides valuable insights into evolutionary conservation and functional specialization. The Sumatran orangutan (Pongo abelii) FTSJD1 shares significant sequence similarity with homologs in other primates, particularly in the catalytic methyltransferase domain. The CHORI-276 Sumatran orangutan BAC library has facilitated genetic analysis of Pongo abelii, with DNA samples obtained from specific individuals including female Sumatran orangutan "Susie" (Studbook #1044; ISIS #71) .

Preparation of genomic resources for comparative studies typically involves DNA isolation from white blood cells, followed by partial digestion, size fractionation, and cloning into appropriate vectors . These resources enable detailed comparative genomics studies examining FTSJD1 sequence conservation and divergence across species. Key structural features to examine include the catalytic domain organization, substrate binding regions, and regulatory elements.

Functional comparison studies should assess both substrate specificity and catalytic efficiency across species. Established methodologies include recombinant expression of FTSJD1 orthologs from multiple species, followed by parallel biochemical characterization. Expression pattern analysis across tissues and developmental stages provides additional comparative data regarding potential functional specialization. These comparative approaches illuminate evolutionary pressures shaping FTSJD1 function and identify conserved mechanisms of RNA modification across species.

What research strategies help identify physiological RNA targets of FTSJD1?

Identification of physiological RNA targets represents a central challenge in FTSJD1 research, requiring integration of multiple experimental approaches. Initial target prediction can leverage computational methods analyzing RNA sequence and structural motifs recognized by related methyltransferases. These predictions guide the design of candidate-based validation experiments using in vitro methylation assays with purified recombinant FTSJD1 and synthetic RNA substrates.

Transcriptome-wide approaches provide more comprehensive target identification. These methods typically couple FTSJD1 manipulation (overexpression or depletion) with techniques detecting RNA methylation. For 2'-O-methylation specifically, approaches include reverse transcription-based methods that exploit the altered properties of modified nucleotides during cDNA synthesis. Mass spectrometry offers complementary approaches for direct detection of methylated nucleotides.

Cross-linking immunoprecipitation (CLIP) methods adapted for RNA modification enzymes can identify direct FTSJD1-RNA interactions in cellular contexts. These approaches involve UV cross-linking of protein-RNA complexes, followed by immunoprecipitation of FTSJD1 and sequencing of associated RNAs. Integration of binding data with methylation mapping provides the most robust evidence for direct FTSJD1 targets. Validation studies should examine the functional consequences of FTSJD1-mediated methylation on target RNA stability, structure, and function.

How might FTSJD1 mutations or dysregulation contribute to disease pathology?

Although direct evidence linking FTSJD1 specifically to disease remains limited, research on related RNA methyltransferases suggests potential pathological implications. Disruption of RNA modification mechanisms broadly impacts post-transcriptional gene regulation, potentially contributing to various disease processes. Several genetic loci associated with inflammatory disorders, including Crohn's disease, overlap with regions containing RNA modification genes, suggesting potential relevance to FTSJD1 research .

The rs3180018 locus at 1q22 (153.24-154.39 Mb) shows associations with both type 2 diabetes and asthma, with nearby genes potentially involved in RNA processing pathways . Similarly, the rs1998598 locus at 1q31 (195.58-196.21 Mb) demonstrates association with asthma . These genetic associations suggest RNA regulatory networks may contribute to inflammatory and metabolic disease mechanisms, potentially involving methyltransferases like FTSJD1.

Investigation of FTSJD1's potential role in disease requires examining expression patterns in relevant tissues, functional impacts of disease-associated variants, and consequences of dysregulation in cellular and animal models. Quasi-experimental study designs, particularly interrupted time-series approaches, provide frameworks for evaluating FTSJD1's contribution to disease progression or therapeutic response . Research should focus on identifying specific RNA targets affected by FTSJD1 dysfunction and the downstream consequences for cellular processes implicated in disease pathology.

What research design approaches best address contradictory findings in FTSJD1 research?

Addressing contradictory findings in FTSJD1 research requires robust experimental design strategies that systematically evaluate potential sources of discrepancy. The hierarchy of quasi-experimental designs provides a framework for developing increasingly rigorous approaches . When contradictory findings emerge, researchers should first examine methodological differences including expression systems, purification methods, and assay conditions that might contribute to discrepant results.

Replication studies represent an essential step, ideally implementing the untreated control group design with dependent pretest and posttest samples using a double pretest (Intervention group: O1a O2a X O3a; Control group: O1b O2b O3b) . This design provides robust controls for time-dependent effects and pre-existing trends that might confound interpretation. The switching replications design (Intervention group: O1a X O2a O3a; Control group: O1b O2b X O3b) offers additional advantages by implementing the intervention across both groups at different timepoints, controlling for group-specific effects .

Meta-analysis approaches can systematically integrate findings across studies, accounting for methodological heterogeneity. This strategy has proven effective in other research domains, as demonstrated by meta-analyses that have expanded the number of confirmed susceptibility loci for various diseases . For FTSJD1 specifically, researchers should develop standardized protocols for protein expression, activity assessment, and experimental design to facilitate cross-study comparison and replication efforts.

Experimental Design Approaches for Resolving FTSJD1 Research Contradictions
Design Type
-------------
One-group pretest-posttest
Removed-treatment
Untreated control with pretest-posttest
Double pretest design
Switching replications
Interrupted time-series

How can structural biology approaches enhance understanding of FTSJD1 function?

Structural biology approaches provide critical insights into FTSJD1 function by elucidating three-dimensional protein organization, substrate binding mechanisms, and catalytic activities. X-ray crystallography represents a traditional approach for obtaining high-resolution structures, requiring preparation of highly pure, monodisperse FTSJD1 samples capable of forming well-ordered crystals. This approach has successfully resolved structures of related methyltransferases, revealing conserved catalytic domains and substrate recognition features.

Nuclear magnetic resonance (NMR) spectroscopy offers complementary structural information, particularly regarding protein dynamics and conformational changes upon substrate binding. For proteins of FTSJD1's size (approximately 19.8 kDa), NMR provides feasible structural determination while capturing dynamic properties relevant to catalytic function . Cryo-electron microscopy (cryo-EM) has emerged as another powerful approach, particularly valuable for studying FTSJD1 in complex with larger RNA substrates or protein binding partners.

Computational approaches including homology modeling and molecular dynamics simulations complement experimental structural biology. These methods predict FTSJD1 structure based on related proteins with known structures and simulate dynamic interactions with substrates. Integration of structural data with functional studies creates mechanistic models explaining how FTSJD1 recognizes specific RNA targets and catalyzes methyl transfer reactions. These insights guide rational design of tools for manipulating FTSJD1 activity, including specific inhibitors or activity probes valuable for further functional investigation.

What quality control measures ensure reproducible results in FTSJD1 research?

Ensuring reproducible results in FTSJD1 research requires implementing rigorous quality control measures throughout the experimental workflow. For recombinant protein production, batch-to-batch consistency checks should include SDS-PAGE analysis, with documented achievement of >85% purity for similar Pongo abelii recombinants . Activity assays using standardized substrates provide critical functional validation, ensuring the recombinant protein maintains catalytic activity.

Mass spectrometry verification confirms protein identity and detects potential post-translational modifications or degradation products that might affect activity. Biophysical characterization using circular dichroism spectroscopy and thermal stability assays assesses proper protein folding and stability under experimental conditions. For complex experimental designs, particularly quasi-experimental approaches, systematic documentation of all variables including cell passage number, reagent sources, and environmental conditions enhances reproducibility .

Statistical considerations remain paramount, with power calculations guiding sample size determination and appropriate statistical tests selected based on data distribution properties. The removed-treatment design (O1 X O2 O3 removeX O4) offers particular advantages for validating causality, as it demonstrates both the effect of introducing FTSJD1 manipulation and its subsequent removal . Documentation standards should include detailed methods sections enabling complete protocol reproduction, with particular attention to often-omitted details such as incubation times, buffer compositions, and equipment specifications.

What specialized techniques optimize detection of FTSJD1-mediated RNA modifications?

Detection of FTSJD1-mediated RNA modifications requires specialized techniques that identify methylation with high sensitivity and specificity. Antibody-based approaches represent one strategy, employing immunoprecipitation with antibodies recognizing 2'-O-methylated nucleotides followed by next-generation sequencing (MeRIP-seq). This approach enables transcriptome-wide identification of methylated RNA sites, though antibody specificity remains a critical consideration.

Chemical approaches offer alternative detection strategies, exploiting the differential reactivity of methylated versus unmethylated nucleotides. Reverse transcription-based methods are particularly valuable, as 2'-O-methylation can cause RT stops or decreased efficiency under limiting nucleotide concentrations. These properties enable development of high-throughput mapping approaches for identifying methylation sites across the transcriptome.

Mass spectrometry provides the most direct method for methylation detection, offering nucleotide-level resolution and quantitative measurement of modification levels. This approach typically involves RNA digestion to nucleosides followed by liquid chromatography-mass spectrometry analysis. Integration of these complementary detection methods provides comprehensive characterization of FTSJD1-mediated RNA modifications. Researchers should implement appropriate controls, including comparison with samples expressing catalytically inactive FTSJD1 mutants, to distinguish specific methylation events from background signals.

Comparison of RNA Methylation Detection Methods for FTSJD1 Research
Method
--------
Antibody-based (MeRIP-seq)
RT-based detection
Mass spectrometry
Nanopore direct RNA sequencing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.