Recombinant Pongo abelii GDP-Man:Man (3)GlcNAc (2)-PP-Dol alpha-1,2-mannosyltransferase (ALG11)

Shipped with Ice Packs
In Stock

Description

General Information

Pongo abelii refers to the Sumatran orangutan, and the "recombinant" prefix indicates that the enzyme is produced using recombinant DNA technology, where the gene encoding the enzyme is expressed in a host cell . This approach allows for the production of large quantities of the enzyme for research and industrial purposes.

Function

ALG11 functions as an alpha-1,2-mannosyltransferase, which means it links a mannose residue to the existing glycan structure via an alpha-1,2-linkage. The specific substrate for this enzyme is GDP-Man:Man(3)GlcNAc(2)-PP-Dol . The enzyme is localized to the cytosolic side of the endoplasmic reticulum (ER) .

Structure

The RCSB PDB provides a computed structural model of GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase, although it is based on Saccharomyces cerevisiae (yeast) rather than Pongo abelii . The model's confidence is high, with a global pLDDT score of 90.77 .

Production

Recombinant ALG11 is typically produced in cell-free expression systems . The purity of the recombinant protein is generally greater than or equal to 85%, as determined by SDS-PAGE .

Synonyms

ALG11 has several synonyms, including:

  • GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase

  • Alpha-1,2-mannosyltransferase ALG11

  • Asparagine-linked glycosylation protein 11

  • Glycolipid 2-alpha-mannosyltransferase

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ALG11; GDP-Man:Man(3GlcNAc(2-PP-Dol alpha-1,2-mannosyltransferase; Asparagine-linked glycosylation protein 11 homolog; Glycolipid 2-alpha-mannosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-492
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MAAGERSWCLCKLLRFFYSLFFPGLIVCGTLCVCLVIVLWGIRLLLQRKKKLVSTSKNGK NQMVIAFFHPYCNAGGGGERVLWCALRALQKKYPEAVYVVYTGDVNVNGQQILEGAFRRF NIRLIHPVQFVFLRKRYLVEDSLYPHFTLLGQSLGSIFLGWEALMQCVPDVYIDSMGYAF TLPLFKYIGGCQVGSYVHYPTISTDMLSVVKNQNIGFNNAAFITRNPFLSKVKLIYYYLF AFIYGLVGSCSDVVMVNSSWTLNHILSLWKVGNCTNIVYPPCDVQTFLDIPLHEKKMTPG HLLVSVGQFRPEKNHPLQIRAFAKLLNKKMVESPPSLKLVFIGGCRNKDDELRVNQLRRL SEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTIILAHNSG GPKLDIVVPHEGDITGFLAESEEDYAETIAHILSMSAEKRLQIRKSARASVSRFSDQEFE VTFLSSVEKLFK
Uniprot No.

Target Background

Function

Mannosyltransferase involved in the final steps of Man5GlcNAc2-PP-dolichol core oligosaccharide synthesis on the cytoplasmic face of the endoplasmic reticulum. It catalyzes the addition of the fourth and fifth mannose residues to the dolichol-linked oligosaccharide chain.

Database Links
Protein Families
Glycosyltransferase group 1 family, Glycosyltransferase 4 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is ALG11 and what is its precise role in the N-glycosylation pathway?

ALG11 is a GDP-Man:Man3GlcNAc2-PP-dolichol-alpha1,2-mannosyltransferase that catalyzes the sequential addition of the fourth and fifth mannose residues during lipid-linked oligosaccharide (LLO) biosynthesis. This enzyme is localized to the cytosolic side of the endoplasmic reticulum (ER) and specifically transfers mannose from GDP-mannose (GDP-Man) to Man3GlcNAc2-PP-dolichol and Man4GlcNAc2-PP-dolichol, resulting in the production of Man5GlcNAc2-PP-dolichol . This step is critical in the early stages of N-glycan assembly, which ultimately affects protein glycosylation throughout the secretory pathway.

ALG11 functions within a highly conserved pathway among eukaryotes, where LLO biosynthesis is catalyzed by fourteen glycosyltransferases in an ordered, stepwise manner . The enzyme's activity is essential for proper N-glycan structure formation, which subsequently influences protein folding, stability, and function.

How is ALG11 conserved across species and what implications does this have for research using recombinant Pongo abelii ALG11?

The N-glycosylation pathway, including ALG11 function, is remarkably conserved across eukaryotic organisms. Annotation of genes involved in the N-glycan pathway can be effectively conducted using comparative genomics approaches with sequences from diverse organisms including Homo sapiens, Mus musculus, Arabidopsis thaliana, Drosophila melanogaster, Saccharomyces cerevisiae, and others . This high degree of conservation suggests that recombinant Pongo abelii ALG11 likely shares significant structural and functional similarities with human ALG11.

Researchers can leverage this conservation to design experiments where Pongo abelii ALG11 might serve as a model for human ALG11 function. For instance, complementation studies in cellular models with defective endogenous ALG11 could be performed, similar to how P. tricornutum GnT I has been shown to restore complex type N-glycan maturation in deficient Chinese hamster ovary cell lines .

What are the validated methods for assessing ALG11 enzymatic activity in vitro?

When assessing ALG11 enzymatic activity, researchers should implement multiple complementary approaches:

  • LLO analysis: This method directly measures the size of lipid-linked oligosaccharide precursors of N-glycans. Functional mutations in ALG11 generate truncated LLO structures. This technique has been successfully employed to confirm ALG11 deficiency in patient fibroblasts .

  • Complementation assays: Similar to studies with GnT I from P. tricornutum, recombinant ALG11 can be tested for its ability to restore proper glycosylation in cell lines with ALG11 deficiency .

  • Biomarker glycosylation analysis: Assessment of hypoglycosylation of specific cellular biomarkers such as GP130. This novel biomarker has proven useful even in cases where traditional markers like transferrin show normal glycosylation profiles .

  • In vitro mannosyltransferase assays: Direct measurement of the transfer of mannose residues from GDP-mannose to appropriate acceptor substrates using radioisotope-labeled or fluorescently-tagged donor substrates.

What expression systems are optimal for producing functional recombinant Pongo abelii ALG11?

For producing functional recombinant ALG11, selection of an appropriate expression system is critical:

When expressing ALG11, it is essential to preserve the native transmembrane domains predicted by bioinformatic tools such as TMHMM, TOPPRED, and HMMTOP . Additionally, proper subcellular targeting to the cytosolic face of the ER is critical for functional studies.

What techniques are most effective for studying the structure-function relationship of ALG11?

Several complementary approaches can be employed to investigate structure-function relationships:

  • Site-directed mutagenesis: Systematic mutation of conserved residues to identify catalytic and substrate-binding sites. This is particularly informative when combined with in vitro activity assays.

  • Domain swapping experiments: Exchange of domains between ALG11 from different species to determine regions responsible for substrate specificity or catalytic activity.

  • Crystallography and structural biology approaches: While challenging for membrane proteins, these techniques provide the most detailed information about protein structure. Detergent screening and lipid cubic phase crystallization may be required.

  • Molecular dynamics simulations: Computational approaches can provide insights into protein-substrate interactions and conformational changes during catalysis.

  • Cross-linking studies: To identify protein-protein interactions within the N-glycosylation machinery.

The integration of structural information with functional data from patient mutations offers a powerful approach to understanding structure-function relationships in ALG11 .

How can researchers differentiate between the fourth and fifth mannose addition activities of ALG11?

ALG11 uniquely catalyzes two sequential mannose addition reactions. To differentiate between these activities:

  • Time-course experiments: Monitoring the appearance of intermediate (Man4GlcNAc2-PP-dolichol) and final (Man5GlcNAc2-PP-dolichol) products over time.

  • Pulse-chase experiments: Using briefly available labeled GDP-mannose followed by excess unlabeled substrate.

  • Site-directed mutagenesis: Creating variants that affect one transfer activity preferentially over the other.

  • Substrate analogs: Designing competitive inhibitors specific to each step.

  • Mass spectrometry analysis: High-resolution MS to distinguish between the Man4 and Man5 intermediates in the pathway.

These approaches can help determine if the two activities have different kinetic parameters or regulatory mechanisms, which would be valuable information for both basic science and therapeutic development.

What are the validated biomarkers for detecting ALG11 dysfunction in research samples?

Several biomarkers have been validated for assessing ALG11 function:

  • GP130 glycosylation status: This novel biomarker has been shown to reveal cellular hypoglycosylation even in cases where traditional markers appear normal . Analysis of GP130 is particularly valuable for research involving ALG11 function.

  • Lipid-linked oligosaccharide (LLO) analysis: Direct examination of LLO size can detect the truncated structures characteristic of ALG11 deficiency .

  • Transferrin glycosylation: Traditional carbohydrate deficient transferrin analysis by mass spectrometry can detect abnormal N-glycosylation in many cases of ALG11 deficiency, though it may appear normal in some instances .

The table below summarizes the comparative sensitivity of different biomarkers for ALG11 dysfunction:

BiomarkerDetection MethodSensitivity for ALG11 DysfunctionNotes
GP130Western blotHighCan detect abnormalities even when other markers are normal
LLOHPLC/MS analysisHighDirect assessment of ALG11 enzymatic products
TransferrinMass spectrometryVariableMay be normal in some ALG11-CDG cases
ALG11 proteinWestern blotLowProtein levels may be normal despite functional defects

How can functional assays be optimized to distinguish ALG11 deficiency from other congenital disorders of glycosylation?

To specifically identify ALG11 deficiency:

  • Sequential enzymatic assays: Measure activities of enzymes acting immediately before and after ALG11 in the pathway to rule out secondary effects.

  • Complementation studies: Introduction of wild-type ALG11 should rescue the glycosylation defect in cells with primary ALG11 deficiency but not in cells with defects in other CDG-related genes.

  • LLO profile analysis: ALG11 deficiency produces a characteristic accumulation of Man3GlcNAc2-PP-dolichol and/or Man4GlcNAc2-PP-dolichol, distinct from patterns seen in other CDGs .

  • Combined biomarker approach: Using multiple biomarkers (GP130, transferrin, LLO analysis) provides higher specificity than any single test .

It is important to note that some patients with confirmed ALG11-CDG present with normal transferrin glycosylation profiles, which had not been reported previously in the literature . Therefore, normal screening results from carbohydrate deficient transferrin tests do not rule out ALG11-CDG, a feature also observed in other N-linked CDGs such as PMM2-CDG .

What are the current challenges in studying recombinant ALG11 and how might they be addressed?

Research with recombinant ALG11 faces several challenges:

  • Membrane protein expression: As an ER-resident membrane protein, ALG11 can be difficult to express in functional form. This may be addressed by:

    • Optimizing detergent conditions for extraction

    • Creating fusion proteins to enhance solubility

    • Using nanodiscs or lipid bilayers to maintain native environment

  • Enzymatic assay development: The sequential nature of ALG11's dual mannosyltransferase activity complicates kinetic analyses. Researchers can:

    • Develop synthetic or semi-synthetic substrates

    • Establish coupled assay systems

    • Implement high-sensitivity detection methods for product formation

  • Structural characterization: Obtaining crystal structures of membrane glycosyltransferases remains challenging. Alternative approaches include:

    • Cryo-electron microscopy

    • Homology modeling based on related structures

    • HDX-MS (hydrogen-deuterium exchange mass spectrometry) for dynamics information

  • Substrate availability: Natural substrates for ALG11 (Man3GlcNAc2-PP-dolichol and Man4GlcNAc2-PP-dolichol) are complex to synthesize. Strategies include:

    • Enzymatic preparation from precursors

    • Development of simplified substrate analogs

    • Chemoenzymatic synthesis approaches

How can evolutionary studies of ALG11 inform research using the Pongo abelii ortholog?

Evolutionary analysis of ALG11 can provide valuable insights:

  • Sequence conservation analysis: Identification of absolutely conserved residues across diverse species can highlight critical functional domains. Phylogenetic trees can be constructed using tools like Phylogeny.fr to understand the evolutionary relationships between ALG11 from different species.

  • Species-specific adaptations: Comparing ALG11 sequences from humans, non-human primates, and more distant relatives can reveal adaptive changes that might affect enzyme properties.

  • Functional divergence: Testing orthologs from different species can identify functional differences that correlate with evolutionary distance. For instance, the approach used to demonstrate GnT I activity across species could be applied to ALG11.

  • Structure prediction: Using multiple sequence alignments of ALG11 from diverse species can improve the accuracy of structure prediction algorithms and help identify functionally important regions.

The high conservation of N-glycosylation pathways suggests that the Pongo abelii ALG11 likely retains core functions similar to human ALG11, making it a valuable research tool.

What is the current understanding of genotype-phenotype correlations in ALG11-CDG?

ALG11-CDG (also known as congenital disorder of glycosylation type Ip) is a rare inherited metabolic disorder caused by mutations in the ALG11 gene. Current understanding of genotype-phenotype correlations includes:

  • Clinical spectrum: The phenotype typically includes severe psychomotor disabilities, epilepsy, and in some cases, microcephaly and skeletal abnormalities . Some patients present with fetal brain disruption sequence, characterized by severe microcephaly, scalp rugae, and occipital bone prominence .

  • Mutational spectrum: Multiple pathogenic variants have been reported in ALG11, with ten patients described in the literature prior to 2019 . Novel mutations continue to be identified, expanding the known mutational spectrum of ALG11-CDG.

  • Biochemical phenotype: Patients typically show:

    • Truncated LLO structures consistent with ALG11 dysfunction

    • Hypoglycosylation of cellular biomarkers like GP130

    • Variable transferrin glycosylation profiles, with some patients showing normal patterns

  • Severity correlation: There appears to be some correlation between the degree of enzymatic impairment and clinical severity, though more research is needed to establish clear relationships.

How can researchers develop and validate cellular models of ALG11 deficiency?

Development of cellular models for ALG11 deficiency research:

  • Patient-derived fibroblasts: Primary cells from ALG11-CDG patients provide the most physiologically relevant model. These have been successfully used to characterize hypoglycosylation patterns and validate ALG11 mutations .

  • CRISPR/Cas9 engineered cell lines: Introduction of specific ALG11 mutations in appropriate cell types can create models with defined genetic backgrounds. This approach is particularly valuable for studying specific variants of unknown significance.

  • siRNA/shRNA knockdown models: Transient or stable reduction of ALG11 expression can model partial deficiency and allow for rescue experiments.

  • Heterologous expression systems: Similar to how GnT I functionality was tested in CHO Lec1 mutants , ALG11-deficient cell lines can be complemented with wild-type or mutant forms of ALG11 to assess function.

Validation of these models should include:

  • Confirmation of ALG11 expression/activity levels

  • Analysis of LLO profiles

  • Assessment of N-glycan structures on cellular glycoproteins

  • Verification of characteristic biomarker abnormalities, especially GP130 glycosylation

  • Complementation with wild-type ALG11 to confirm that observed defects are specifically due to ALG11 deficiency

What novel therapeutic approaches might be explored for ALG11-related disorders based on structural and functional studies?

Understanding of ALG11 structure and function opens several potential therapeutic avenues:

  • Small molecule chaperones: For missense mutations that affect protein folding rather than catalytic function, small molecules that stabilize ALG11 structure might restore partial function.

  • Substrate supplementation: Theoretically, providing cells with downstream glycan intermediates could bypass ALG11 deficiency, though delivery to the ER remains challenging.

  • Gene therapy approaches: Targeted delivery of functional ALG11 gene to affected tissues, particularly for neurological manifestations.

  • Antisense oligonucleotides: For specific splicing mutations, ASOs might redirect splicing to produce functional protein.

  • Structure-based drug design: With improved structural understanding of ALG11, small molecules could be designed to enhance residual activity of mutant enzymes.

  • Metabolic bypass strategies: Exploiting alternative glycosylation pathways that might compensate for defective ALG11 function.

Research in other glycosylation disorders indicates that even partial restoration of glycosylation function might significantly improve clinical outcomes, making ALG11 an important therapeutic target.

How might high-throughput screening approaches be optimized for identifying compounds that modulate ALG11 activity?

Developing effective high-throughput screens for ALG11 modulators requires:

  • Reporter systems: Creation of cell-based assays where ALG11 activity is linked to easily measurable outputs such as:

    • Fluorescent protein folding/trafficking reporters dependent on proper glycosylation

    • Surface expression of proteins requiring ALG11-dependent glycosylation

    • FRET-based sensors of glycosylation status

  • In vitro assay adaptation: Miniaturization and optimization of biochemical assays measuring:

    • GDP release during mannosyltransferase activity

    • Formation of Man5GlcNAc2-PP-dolichol product

    • Consumption of Man3GlcNAc2-PP-dolichol substrate

  • Compound libraries: Rational selection of compound libraries targeting:

    • Known glycosyltransferase modulators

    • Molecules affecting related metabolic pathways

    • Natural products from organisms with robust N-glycosylation systems

  • Orthogonal validation: Secondary assays to confirm hits, including:

    • Direct measurement of ALG11 activity

    • Analysis of cellular N-glycan profiles

    • Assessment of GP130 and other biomarker glycosylation

Such screening approaches could identify both research tools to study ALG11 function and potential therapeutic leads for ALG11-CDG.

What are the critical controls required when performing functional complementation studies with recombinant ALG11?

Robust complementation studies with recombinant ALG11 require:

  • Negative controls:

    • Empty vector transfection

    • Expression of catalytically inactive ALG11 mutant

    • Unrelated glycosyltransferase expression

  • Positive controls:

    • Complementation with wild-type human ALG11

    • Parallel complementation in a model with known rescue parameters

  • Expression controls:

    • Verification of ALG11 protein expression levels

    • Assessment of proper subcellular localization

    • Confirmation of membrane integration

  • Functional readouts:

    • LLO profile analysis

    • N-glycan structural analysis

    • Glycoprotein biomarker assessment (particularly GP130)

    • Cell growth/viability in systems where ALG11 is essential

The approach used in demonstrating functional complementation of GnT I activity in CHO Lec1 mutants provides an excellent methodological template for ALG11 studies.

How should researchers interpret discrepancies between transferrin glycosylation profiles and cellular biomarkers like GP130 in ALG11 studies?

When faced with discrepancies between different glycosylation biomarkers:

  • Prioritize multiple lines of evidence: No single biomarker is perfect. Recent research has shown that patients with ALG11-CDG can present with normal transferrin glycosylation profiles despite clear functional defects demonstrated by other methods .

  • Consider tissue-specific effects: Transferrin predominantly reflects hepatic N-glycosylation, while cellular biomarkers like GP130 might better represent glycosylation in other tissues.

  • Evaluate assay sensitivity: GP130 analysis has been shown to detect hypoglycosylation in cases where transferrin appears normal , suggesting higher sensitivity for subtle defects.

  • Assess functional impact: Direct measurement of ALG11 enzymatic activity through LLO analysis provides the most definitive evidence of ALG11 dysfunction .

  • Understand compensatory mechanisms: Some tissues or proteins may have mechanisms to partially compensate for ALG11 deficiency, leading to variable glycosylation profiles.

It is important to note that normal screening test results via carbohydrate deficient transferrin do not rule out an N-linked CDG, including the most common form, PMM2-CDG . Therefore, comprehensive assessment using multiple biomarkers provides the most reliable evaluation of ALG11 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.