Recombinant Pongo abelii Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pongo abelii Homocysteine-Responsive Endoplasmic Reticulum-Resident Ubiquitin-Like Domain Member 1 Protein (HERPUD1)

Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein (HERPUD1) is a protein that, in humans, is encoded by the HERPUD1 gene . HERPUD1 is a 54 kDa protein located in the endoplasmic reticulum (ER) membrane and is known to play a crucial role in the retrotranslocation step of ER-associated degradation (ERAD) .

The Role of HERPUD1 in ER-Associated Degradation (ERAD)

The accumulation of unfolded proteins in the endoplasmic reticulum (ER) triggers the ER stress response . This response includes the inhibition of translation to prevent further accumulation of unfolded proteins, the increased expression of proteins involved in polypeptide folding, known as the unfolded protein response (UPR), and the destruction of misfolded proteins by the ER-associated protein degradation (ERAD) system . HERPUD1 functions as one of the main components of ER-associated degradation (ERAD) . ERAD is a mechanism that targets potentially proteotoxic proteins with folding defects . The ERAD process includes:

  1. Substrate recognition

  2. Initiation of retrotranslocation (translocation in the lipid bilayer)

  3. Ubiquitination

  4. Targeting to the 26S proteasome

  5. Proteasomal degradation

HERPUD1 regulates ERAD by interacting with proteins involved in retrotranslocation, ubiquitination, and degradation of misfolded proteins . It stabilizes the ERAD multiprotein complex and directs misfolded proteins to degradation, acting as a shuttle protein in the retrotranslocation step of ERAD .

HERPUD1 Interactions and Functions

HERPUD1 interacts in the ER membrane with several proteins :

  • Hrd1/SYVN1: An E3 ligase enzyme responsible for protein ubiquitination required to target misfolded proteins to proteasomal degradation

  • Ubiquitin molecule

  • Adaptor subunit SEL1L

  • OS-9 acting as a lectin

  • Derlin1, a component of the channel complex

HERPUD1 controls the proteasomal degradation of the inositol 1,4,5-triphosphate receptor and ryanodine receptor proteins, which is a $$Ca^{+2}$$ channel and has a critical role in $$Ca^{+2}$$ homeostasis .

HERPUD1 Expression and Tissue Distribution

HERPUD1 expression is widely distributed in all tissues, with high levels reported in tissues with advanced secretory ability, such as the pancreas . This suggests that HERPUD1 may play essential roles in tissues with high secretory properties, such as breast and prostate .

HERPUD1 and Macroautophagy

Stabilized HERPUD1 downregulates macroautophagy, favoring a closed interplay between the ER and lysosomes, which impacts drug-cell interactions . Deletion of the UBL domain in HERPUD1 causes a decrease in basal and induced autophagy and promotes ER remodeling independent of the unfolded protein response activation into stacked tubular structures . Higher HERPUD1 stability has a positive impact on lysosomal function, promoting an expanded ER-lysosomal network .

HERPUD1 and ER Remodeling

HERPUD1 stability can be linked with ER remodeling . Cells expressing HERPUD1-ΔUBL present a large and dense ER network extending throughout the entire cytoplasm, including the periphery of the cell, compared to the less extended ER network observed in HERPUD1-WT cells . HERPUD1-ΔUBL increases the volume of the ER and the ER remodeling compared to the expression of HERPUD1-WT .

Quantitative analysis showed a significant increase in the ER volume with the expression of HERPUD1-ΔUBL (2361 ± 967), compared to HERPUD1-WT (1700 ± 689) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HERPUD1; Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSG KLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDS SSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ YYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQFPAENQPANQNAAPQVVVNPGA NQNLRMNAQGGPIVEEDDEINRDWLDWTYSAATFSVFLSILYFYSSLSRFLMVMGATVVM YLHHVGWFPFRPRPVQNFPNDGPPPDIVNQDPNNNLQEGTDPETEDPNHVPPDRGVLDGE QTGPSFMSTAWLVFKTFFASLLPEGPPAIAN
Uniprot No.

Target Background

Function

Recombinant Pongo abelii Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 (HERPUD1) is a component of the endoplasmic reticulum quality control (ERQC) system, also known as ER-associated degradation (ERAD). It participates in the ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. HERPUD1 binds to ubiquilins; this interaction is essential for the efficient degradation of CD3D via the ERAD pathway.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of HERPUD1?

HERPUD1 contains an N-terminal ubiquitin-like (UBL) domain that is crucial for its regulatory degradation and function. The protein serves as a component of the endoplasmic reticulum-associated degradation (ERAD) complex, which contributes to protein quality control in the ER . The UBL domain interacts with the ERAD system, playing a critical role in the clearance of misfolded proteins. Additionally, HERPUD1 participates in both the unfolded protein response (UPR) and calcium signaling regulation through its involvement with inositol 1,4,5-trisphosphate receptor (IP3R) degradation .

To study these functions, researchers should consider domain-specific mutagenesis approaches, particularly focusing on the UBL domain and phosphorylation sites like Ser59, which have been shown to significantly impact HERPUD1 stability and function.

How does HERPUD1 respond to cellular stress conditions?

HERPUD1 expression is significantly induced under ER stress conditions. When unfolded proteins accumulate in the ER, the UPR activates and increases HERPUD1 expression through an ER stress response element in its promoter region . In experimental models using tunicamycin (an inhibitor of N-linked glycosylation) or thapsigargin (a blocker of ER Ca2+ import), HERPUD1 protein levels increase substantially, with studies showing up to 6.5-fold increases in cardiomyocytes after tunicamycin treatment .

Similarly, oxidative stress induced by H₂O₂ treatment (100μM for 2 hours) has been shown to increase HERPUD1 protein levels by approximately 1.3-fold . This upregulation appears to be a protective mechanism, as downregulation of HERPUD1 exacerbates both ER stress and oxidative stress-induced cellular damage.

What are the established methods for producing recombinant HERPUD1?

To produce recombinant HERPUD1, researchers typically employ mammalian expression systems rather than bacterial systems due to the importance of post-translational modifications like phosphorylation for HERPUD1 function. The most common approach involves:

  • Cloning the full-length HERPUD1 cDNA into a mammalian expression vector (e.g., pcDNA3.1) with an appropriate tag (FLAG or HA tags are commonly used)

  • Generating stable cell lines (HeLa cells are frequently employed) through transfection and antibiotic selection

  • Verifying expression through Western blotting using anti-HERPUD1 or anti-tag antibodies

For studying specific domains, constructs lacking the UBL domain (HERPUD1-ΔUBL) or containing point mutations at critical residues (such as the S59D phosphomimetic mutation) can be generated through site-directed mutagenesis .

How does stabilization of HERPUD1 through UBL domain deletion affect autophagy and ER remodeling?

The deletion of the UBL domain in HERPUD1 (HERPUD1-ΔUBL) prevents its proteasomal degradation, resulting in a stabilized form of the protein. When HERPUD1-ΔUBL is expressed in cells, it causes a significant decrease in both basal and induced autophagy, as evidenced by a reduced LC3-II/LC3-I ratio . Specifically, the LC3-II/LC3-I ratio in HERPUD1-ΔUBL cells treated with bafilomycin A1 (BafA1) is reduced to 0.94 ± 0.37, compared to 3.01 ± 0.78 in control cells.

This stabilization also promotes extensive ER remodeling independent of UPR activation. The remodeled ER appears as stacked tubular structures resembling previously described tubular ER rearrangements. To investigate this phenotype experimentally:

  • Generate stable cell lines expressing wild-type HERPUD1 and HERPUD1-ΔUBL

  • Assess autophagy markers (LC3-II/LC3-I ratio) under both basal conditions and after treatment with autophagy inducers (e.g., EBSS starvation medium) and inhibitors (e.g., BafA1)

  • Visualize ER morphology using immunofluorescence with antibodies against ER markers such as CALNEXIN and GRP94

  • Confirm that the observed ER remodeling is not due to UPR activation by analyzing XBP1 mRNA splicing (a hallmark of UPR)

This methodology allows for a comprehensive characterization of how HERPUD1 stability impacts both autophagy and ER structure.

What is the role of HERPUD1 phosphorylation in regulating its function and stability?

Phosphorylation of HERPUD1, particularly at Ser59 within the UBL domain, appears to be a critical regulatory mechanism. The phosphomimetic S59D mutation mimics the effect of UBL domain deletion, suggesting that phosphorylation at this site may serve as a physiological mechanism to regulate HERPUD1 stability and function .

To investigate the role of phosphorylation experimentally:

  • Generate phosphoinert (S59A) and phosphomimetic (S59D) mutants through site-directed mutagenesis

  • Establish stable cell lines expressing these mutants

  • Compare protein stability using cycloheximide chase assays or proteasome inhibitors (e.g., MG132)

  • Assess the impact on autophagy, ER morphology, and lysosomal function

Additionally, mass spectrometry can be employed to identify in vivo phosphorylation sites, and phospho-specific antibodies can be developed to monitor phosphorylation status under different cellular conditions. Kinase prediction tools (e.g., KinasePhos2.0) can help identify potential kinases responsible for HERPUD1 phosphorylation, which can then be validated through kinase inhibitor studies or kinase knockdown/knockout approaches.

How does HERPUD1 influence the ER-lysosomal network and what are the implications for cellular stress responses?

HERPUD1 stabilization promotes an expanded ER-lysosomal network with increased ER-lysosomal membrane contact sites. This network remodeling has a positive impact on lysosomal function and appears to promote cell survival under stress conditions .

To experimentally investigate this phenomenon:

  • Use fluorescent markers or antibodies to simultaneously visualize ER and lysosomes in cells expressing wild-type HERPUD1, HERPUD1-ΔUBL, or S59D mutant

  • Employ super-resolution microscopy to visualize membrane contact sites between the ER and lysosomes

  • Assess lysosomal function using assays for lysosomal pH, proteolytic activity, or degradation of specific substrates

  • Evaluate cell survival under various stress conditions (e.g., drug treatments, nutrient deprivation)

These approaches can help elucidate how HERPUD1-mediated remodeling of the ER-lysosomal network contributes to cellular stress responses and potential therapeutic applications in diseases involving ER stress.

What controls are necessary when studying HERPUD1 in experimental models?

When designing experiments to study HERPUD1, several critical controls should be included:

  • Expression level controls: Since overexpression can lead to artifacts, compare expression levels of recombinant HERPUD1 to endogenous levels using quantitative Western blotting.

  • Domain-specific controls: Include both wild-type HERPUD1 and domain mutants (HERPUD1-ΔUBL) to distinguish between effects due to HERPUD1 presence versus specific domain functions.

  • HERPUD1 knockdown/knockout controls: Use siRNA or CRISPR-Cas9 to validate phenotypes observed with overexpression by demonstrating opposite effects with HERPUD1 depletion.

  • ER stress controls: Include positive controls for ER stress (tunicamycin or thapsigargin treatment) and measure established ER stress markers (CHOP, BiP, XBP1 splicing) to distinguish between direct HERPUD1 effects and secondary effects due to ER stress induction.

  • Cell type controls: Compare HERPUD1 function across multiple cell types, as its effects may be cell type-specific.

Control TypePurposeMethodology
Expression LevelAvoid artifacts from overexpressionQuantitative Western blot comparing to endogenous protein
Domain FunctionDistinguish general vs. domain-specific effectsInclude wild-type and domain mutants (ΔUBL, S59A, S59D)
Loss-of-FunctionValidate gain-of-function observationssiRNA knockdown or CRISPR-Cas9 knockout
ER StressSeparate direct HERPUD1 effects from ER stressMeasure CHOP, BiP, XBP1 splicing
Cell Type VariationIdentify cell type-specific functionsTest in multiple cell lines and primary cells

How can researchers effectively study the role of HERPUD1 in cardiac pathology?

Given HERPUD1's role in cardiac hypertrophy , researchers should consider the following methodological approaches:

  • Animal models: Both global and cardiac-specific Herpud1 knockout mice can be used to study the role of HERPUD1 in cardiac function. Cardiac hypertrophy can be induced via pressure overload (transverse aortic constriction) or agonist stimulation (e.g., angiotensin II infusion).

  • Cellular models: Neonatal rat ventricular myocytes (NRVMs) are commonly used, with HERPUD1 levels modulated through siRNA knockdown or overexpression of wild-type or mutant constructs.

  • Hypertrophy assessment:

    • In vivo: Echocardiography to measure heart function and dimensions; histological analysis to assess cardiomyocyte size and fibrosis

    • In vitro: Measurement of cell surface area, protein synthesis rates, and expression of hypertrophic marker genes (Myhβ)

  • Molecular mechanisms:

    • Measure IP3R levels, as HERPUD1 regulates IP3R degradation

    • Assess calcium signaling using fluorescent calcium indicators

    • Evaluate activation of hypertrophic signaling pathways (calcineurin/NFAT)

For studying oxidative stress and ER stress responses, H₂O₂ treatment (100μM, 2h) and tunicamycin treatment (10μg/ml, 12h) are established protocols to induce these stresses in cardiomyocytes .

How should researchers interpret contradictory findings regarding HERPUD1 function?

Contradictory findings regarding HERPUD1 function may arise due to several factors:

  • Context-dependent effects: HERPUD1 may function differently depending on cell type, stress conditions, or expression levels. When comparing contradictory studies, carefully note the experimental systems used (cell lines, primary cells, animal models) and the specific conditions (basal vs. stressed).

  • Stable vs. transient expression: Stable expression of HERPUD1 may lead to adaptive responses that are not observed with transient expression. For example, while transient expression of HERPUD1-ΔUBL has been characterized previously , stable expression reveals additional phenotypes related to ER remodeling and the ER-lysosomal network.

  • Isoform differences: Alternative splicing of HERPUD1 produces multiple transcript variants encoding different isoforms . Ensure that the specific isoform being studied is clearly identified and consistently used across experiments.

  • Species differences: When comparing findings from different species (human, mouse, rat, or Pongo abelii), consider potential species-specific functions or regulation of HERPUD1.

To resolve contradictions, perform comprehensive experiments that systematically vary these parameters while maintaining consistent readouts.

What methodological challenges commonly arise when working with recombinant HERPUD1 and how can they be addressed?

Several challenges may arise when working with recombinant HERPUD1:

  • Protein stability issues: Wild-type HERPUD1 is rapidly degraded by the proteasome, making it difficult to achieve consistent expression levels. This can be addressed by:

    • Using proteasome inhibitors (e.g., MG132) during protein extraction

    • Expressing the stabilized HERPUD1-ΔUBL variant for certain applications

    • Creating inducible expression systems to control expression timing

  • Cellular toxicity: High-level expression of HERPUD1 may induce ER stress or ER remodeling, potentially confounding results. Solutions include:

    • Using tetracycline-inducible systems to precisely control expression levels

    • Comparing multiple expression levels to establish dose-response relationships

    • Always including appropriate controls to distinguish between specific HERPUD1 effects and general ER stress responses

  • Antibody specificity: Commercial antibodies against HERPUD1 may cross-react with related proteins or fail to detect specific isoforms. To address this:

    • Validate antibodies using HERPUD1 knockout or knockdown cells

    • Consider using epitope-tagged constructs (FLAG, HA) for detection

    • Confirm key findings with multiple independent antibodies

  • Post-translational modifications: HERPUD1 function is regulated by phosphorylation and potentially other modifications. When studying these:

    • Use phosphatase inhibitors during protein extraction

    • Consider generating phospho-specific antibodies for key sites like Ser59

    • Complement Western blotting with mass spectrometry to identify all modifications

How might HERPUD1's role in autophagy and ER remodeling contribute to neurodegenerative disease research?

HERPUD1 has been shown to interact with presenilin proteins and increase amyloid-beta protein levels following its overexpression , suggesting potential relevance to Alzheimer's disease. Additionally, its role in autophagy regulation and ER remodeling could impact various neurodegenerative conditions:

  • Experimental approaches to investigate HERPUD1 in neurodegeneration:

    • Create neuronal models with modified HERPUD1 expression or stability

    • Assess impact on amyloid-beta processing, tau phosphorylation, and proteostasis

    • Monitor autophagic flux and clearance of aggregation-prone proteins

    • Evaluate ER-lysosomal network functionality in the presence of neurotoxic protein aggregates

  • HERPUD1 as a therapeutic target:

    • Develop small molecules or peptides that modulate HERPUD1 stability (e.g., targeting the S59 phosphorylation)

    • Test whether enhancing HERPUD1 function can promote clearance of misfolded proteins in neurodegenerative disease models

    • Investigate whether HERPUD1-mediated ER remodeling can be harnessed to protect neurons from ER stress-induced cell death

These research directions could provide valuable insights into the role of HERPUD1 in neurodegenerative diseases and potentially identify novel therapeutic approaches.

What emerging technologies could advance our understanding of HERPUD1 function?

Several cutting-edge technologies could significantly enhance our understanding of HERPUD1 biology:

  • Proximity labeling techniques (BioID, APEX) to identify HERPUD1 protein interaction networks under different cellular conditions.

  • High-resolution imaging approaches:

    • Super-resolution microscopy to visualize ER-lysosome contact sites and ER remodeling

    • Live-cell imaging with fluorescently tagged HERPUD1 to monitor dynamics and trafficking

    • Correlative light and electron microscopy to link molecular-level interactions to ultrastructural changes

  • CRISPR-based technologies:

    • CRISPR activation/interference to modulate endogenous HERPUD1 expression

    • Base editing or prime editing to introduce specific mutations (e.g., S59D) at endogenous loci

    • CRISPR screening to identify genetic modifiers of HERPUD1 function

  • Single-cell technologies:

    • Single-cell RNA-seq to investigate cell-to-cell variability in HERPUD1 expression and stress responses

    • Single-cell proteomics to correlate HERPUD1 levels with cellular phenotypes

These methodological advances would provide unprecedented insights into HERPUD1 function and regulation in both normal physiology and disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.