Recombinant Pongo abelii Kelch domain-containing protein 7A (KLHDC7A)

Shipped with Ice Packs
In Stock

Description

Introduction to KLHDC7A

Kelch domain-containing protein 7A (KLHDC7A) is a member of the larger family of proteins characterized by the presence of kelch domains, which are specialized protein structural motifs that typically form β-propeller structures involved in protein-protein interactions. The specific variant found in Pongo abelii (Sumatran orangutan) is of particular interest due to its potential role in comparative studies between human and non-human primate biology.

The Sumatran orangutan (Pongo abelii) represents one of our closest living relatives in the animal kingdom, sharing approximately 97% of its DNA with humans. This genetic proximity makes proteins like KLHDC7A valuable targets for evolutionary studies and biomedical research. Unlike humans and African great apes, orangutans exhibit notable variations in their genetic makeup, particularly in immune-related genes, which may reflect adaptations to different environmental pressures and pathogen exposures throughout their evolutionary history .

KLHDC7A belongs to a diverse family of proteins that participate in various cellular functions, including cytoskeletal organization, gene expression regulation, and cellular signaling pathways. The recombinant form of this protein has become an essential tool for investigating its structure-function relationships and potential applications in biotechnology and pharmaceutical research.

Genetic Information

In the Pongo abelii genome, the KLHDC7A gene is located on chromosome 7 . This chromosomal localization may provide insights into its evolutionary history and potential syntenic relationships with homologous genes in other species, particularly in relation to human KLHDC7A. Chromosomal mapping can reveal important information about the conservation of gene order and potential functional relationships between neighboring genes across species.

The protein is registered in the UniProt database with the accession number Q5R866 , providing a standardized reference point for researchers studying this protein. This database entry includes essential information about the protein's sequence, structure, and potential functions based on computational predictions and experimental evidence.

Recombinant Expression Systems

Recombinant Pongo abelii KLHDC7A is typically produced using heterologous expression systems to generate sufficient quantities for research and analytical purposes. While the specific expression system for Pongo abelii KLHDC7A is not explicitly detailed in the available search results, comparable approaches for human KLHDC7A involve transfection of HEK293T cells with the KLHDC7A open reading frame (ORF) .

The production process generally involves the following steps:

  1. Cloning of the KLHDC7A gene into an appropriate expression vector

  2. Transfection of host cells (such as HEK293T cells) with the expression construct

  3. Culture of transfected cells for protein expression

  4. Cell lysis and protein extraction

  5. Purification of the recombinant protein

The recombinant protein is often tagged to facilitate purification and detection. The tag type is typically determined during the production process based on experimental requirements and downstream applications .

Predicted Functions Based on Homology

While the specific functions of Pongo abelii KLHDC7A have not been comprehensively characterized, insights can be derived from homologous proteins. Based on the STRING interaction network data for human KLHDC7A, there are several predicted functional partners that suggest potential roles for this protein .

One notable homologous protein is KLHDC10 (Kelch domain-containing protein 10), which participates in oxidative stress-induced cell death through MAP3K5 activation and inhibits PPP5C phosphatase activity on MAP3K5 . This suggests that KLHDC7A might also be involved in stress response pathways and cellular signaling related to apoptosis or cell survival.

Predicted Protein Interactions

The STRING database provides information about predicted protein interactions for human KLHDC7A, which may offer clues about the potential interactions of the Pongo abelii ortholog. The top predicted functional partners include:

ProteinFunctionInteraction Score
KLHDC10Oxidative stress-induced cell death through MAP3K5 activation0.486
IGSF21Synaptic inhibition in the brain0.473
PPM1JProtein phosphatase, Mg2+/Mn2+ dependent 1J0.433
SLC25A45Mitochondrial carrier family member0.417
KIAA1549UPF0606 family protein0.411

Current Research Utilization

Recombinant Pongo abelii KLHDC7A has several applications in current research:

  1. Comparative Genomics: Studying the structural and functional differences between KLHDC7A in different primate species can provide insights into evolutionary adaptations and conserved functions.

  2. Immunological Studies: Given that orangutans exhibit unique variations in immune-related genes compared to humans and African great apes , KLHDC7A may be involved in species-specific immune responses.

  3. Protein-Protein Interaction Studies: The kelch domain's role in protein-protein interactions makes KLHDC7A valuable for investigating binding partners and signaling networks.

  4. Enzyme-Linked Immunosorbent Assays (ELISA): Recombinant KLHDC7A is utilized in ELISA-based detection and quantification systems as indicated by commercial availability .

Potential Applications

Based on the predicted functions and homology to other kelch domain-containing proteins, recombinant Pongo abelii KLHDC7A has potential applications in:

  1. Drug Discovery: As a potential target for therapeutic interventions, particularly if involved in disease-relevant pathways.

  2. Biotechnology: Development of novel molecular tools based on the protein's binding properties.

  3. Evolutionary Biology: Understanding the divergence and conservation of kelch domain proteins across primates.

  4. Structural Biology: Determination of three-dimensional structure to understand functional mechanisms and evolutionary changes.

Comparative Analysis with Human KLHDC7A

The human ortholog of KLHDC7A (NM_152375) has been studied in the context of overexpression systems . Comparing the Pongo abelii KLHDC7A with its human counterpart can provide valuable insights into the conservation of function and potentially species-specific adaptations.

Human KLHDC7A overexpression lysates have been prepared using HEK293T cells transfected with KLHDC7A ORF, cultured for 48 hours before collection . The cells are lysed in modified RIPA buffer containing protease inhibitors and phosphatase inhibitors to preserve protein integrity.

This comparative approach allows researchers to investigate:

  1. Functional conservation between human and orangutan KLHDC7A

  2. Species-specific differences in protein structure and function

  3. Evolutionary adaptations reflected in amino acid sequence variations

  4. Differential protein interactions and signaling pathways

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your needs.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag type based on your preference.
Synonyms
KLHDC7A; Kelch domain-containing protein 7A; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-768
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
KLHDC7A
Target Protein Sequence
DWHLDMQLTGKVVLSAAALLLVTVAYRLYKSRPAPAQRWGGNAQAEAKEEAQGSGQPAVQ EASPGVLLTGPRRRRSSKGAEAPQGCSCENPRGPYVLVTGATSTDRKSQRKGSGEERGGQ SSDSEQVPPCCRGQETRTAVSGNPDPPHLPRLGSEPNSSPAGLIAAADGSCAGGELSPPQ DSKPPEHPGLGQLEPPHCHHPAPLQGSSDMNQSWVFTRVIGVNREEAGALEAASDVGLTL HQQEGAPNASYTFSSIARVRMEENFIQKVEGVEPRLKGKVYDYYVESTSQAIFQGRLAPR TAALTEVPSPRPPPRSLGTGAASGGQAGDTKGAAERAASPQPGPSPSTRGFSRKESLLQI AENPELQLQPDGFWLPAPPCPDPGALPGSGRSSQEPHVQLVAGTNFFHIPLTSASAPQVH LDLGNCYEVLTLAKRQNLEALKEAAYKVMSENYLQVLRSPDIYGCLSGAERELILQRRLQ GRQYLVVADVSPKEDSGGLCCYDDELDVWRPLARLPPEAVSRGCAICSLFNYLFVVSGCQ GPGHQPSSRVFCYNPLTGIWSEVCPLNQARPHCRLVALDGHLYAIGGECLNSVERYDPRL DRWDFAPPLPNDTFALAHTATACAKEIFVTGGSLRFLLFRFSAQEQRWWAGPAGGSKDRT AEMVAVNGFLYRFDLNRSLGIAVYRCSASTRLWYECATYRTPYPDAFQCAVVDNLIYCVG RRSTLCFLADSVSPRFVPKELRSFPAPQGTLLPTVLTLPTPDLPQTRV
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the structural composition of KLHDC7A from Pongo abelii?

Kelch domain-containing protein 7A (KLHDC7A) from Pongo abelii (Sumatran orangutan) is a full-length protein comprising 768 amino acids. The complete amino acid sequence contains characteristic Kelch domains that form a β-propeller structure, which typically facilitates protein-protein interactions . The protein is documented in UniProt under accession number Q5R866, and its structural features include multiple Kelch repeat motifs that create the functional domains essential for its biological activity . When working with this protein in laboratory settings, it's important to note that the recombinant form is often optimized with specific buffers (typically Tris-based with 50% glycerol) to maintain structural integrity during storage and experimental procedures .

What experimental considerations are critical when handling recombinant KLHDC7A?

When working with recombinant KLHDC7A, researchers should implement specific handling protocols to maintain protein integrity. The recommended storage conditions include keeping the protein at -20°C for regular storage, with -80°C being preferable for extended storage periods . To prevent protein degradation, repeated freeze-thaw cycles should be avoided as they can compromise structural integrity and biological activity . For ongoing experiments, working aliquots can be maintained at 4°C for up to one week, but longer periods at this temperature are not recommended . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for KLHDC7A stability . When designing experiments, it's advisable to conduct preliminary stability tests under your specific laboratory conditions to ensure optimal protein performance.

How does KLHDC7A function in gene regulatory networks?

KLHDC7A has been identified as a potentially important component in gene regulatory networks, particularly in relation to cancer biology. Research indicates that KLHDC7A may be regulated at the promoter level, with specific genetic variants influencing its expression . The protein's transcription start site appears to be a critical regulatory region, with single nucleotide polymorphisms (SNPs) located near this region having significant effects on promoter activity . Notably, reporter assay studies have demonstrated that constructs containing the risk T-allele of rs2992756, located 84bp from the transcription start site of KLHDC7A, show significantly lower promoter activity compared to reference constructs . This suggests that KLHDC7A expression may be downregulated in individuals carrying this risk allele, potentially contributing to altered cellular processes. Bioinformatic analyses using tools like INQUIST have predicted KLHDC7A to be a target gene with a high score for likelihood of promoter regulation in breast cancer risk analysis .

What quasi-experimental approaches are appropriate for studying KLHDC7A function in disease models?

When investigating KLHDC7A in disease models where true randomized experiments are not feasible, researchers should consider implementing nonequivalent groups design as a quasi-experimental approach. This methodology enables comparison between groups that naturally differ in KLHDC7A expression or function, while controlling for confounding variables through statistical methods . For instance, when studying KLHDC7A variants in patient populations:

Research ComponentImplementation StrategyMethodological Considerations
Group AssignmentSelect groups based on KLHDC7A genetic variants or expression levelsControl for demographic and clinical variables that may confound results
Outcome MeasurementAssess disease progression, treatment response, or cellular phenotypesUse standardized, validated measurement tools with blinded assessment
Confounder ControlImplement statistical adjustment techniques such as propensity score matchingDocument all potential confounders based on biological pathways
Data AnalysisEmploy regression discontinuity analysis for threshold effectsConsider instrumental variable approaches when available

The regression discontinuity approach is particularly valuable when studying the effects of KLHDC7A promoter variants like rs2992756, as it allows researchers to examine outcomes in individuals just above and below expression thresholds, approximating randomized conditions . This design offers higher external validity than laboratory-based experiments while maintaining better internal validity than purely observational studies .

How can reporter assays be optimized to accurately assess KLHDC7A promoter regulation?

When designing reporter assays to study KLHDC7A promoter activity, researchers should implement a comprehensive methodology that accounts for the specific regulatory elements identified in previous studies. Based on research demonstrating that the risk T-allele of rs2992756 significantly reduces KLHDC7A promoter activity , the following protocol optimizations are recommended:

  • Construct design should include the complete promoter region extending at least 500bp upstream and 100bp downstream of the transcription start site to capture all relevant regulatory elements.

  • Site-directed mutagenesis should be employed to generate constructs with different allelic variants of rs2992756 and other potentially functional SNPs identified in association studies.

  • Cell line selection should reflect tissue-specific expression patterns of KLHDC7A, with breast cell lines being particularly relevant given the association with breast cancer risk .

  • Controls must include both empty vector references and constructs containing known promoter elements with established activity levels to normalize results across experimental batches.

  • Transfection efficiency should be monitored using co-transfected reporter systems with distinct readouts from the primary reporter.

Reporter assay results should be validated through complementary approaches such as chromatin immunoprecipitation (ChIP) to confirm transcription factor binding or CRISPR-based approaches to modify endogenous promoter elements, providing a more comprehensive understanding of KLHDC7A regulation in relevant cellular contexts.

What methodological approaches can elucidate the relationship between KLHDC7A and p53 regulatory networks?

Investigating potential interactions between KLHDC7A and p53 regulatory networks requires an integrated multi-omics approach. While direct evidence of KLHDC7A in p53 pathways is limited in the provided search results, methodological frameworks for studying gene regulatory networks can be applied to explore this relationship .

The meta-analysis approach used in p53 research can be adapted to study KLHDC7A by:

  • Compiling multiple expression profiling datasets from various cell types and treatments to generate a comprehensive KLHDC7A Expression Score, similar to methods used for p53 target identification .

  • Integrating chromatin immunoprecipitation (ChIP) data to identify transcription factor binding sites within the KLHDC7A promoter region, particularly focusing on the region containing rs2992756 .

  • Implementing comparative genomics approaches to assess conservation of KLHDC7A regulation across species, which can highlight evolutionarily important regulatory mechanisms .

  • Employing targeted CRISPR screens to systematically test the functional relationship between p53 and KLHDC7A expression under various cellular stresses.

This methodological framework enables researchers to establish whether KLHDC7A functions downstream of p53 or interfaces with p53-dependent pathways, potentially revealing new insights into its role in cancer biology and cellular stress responses.

How does genetic variation in KLHDC7A contribute to breast cancer risk assessment?

The assessment of KLHDC7A genetic variants in breast cancer risk profiling represents an important translational research direction. Evidence indicates that specific regulatory variants, particularly rs2992756 in the KLHDC7A promoter region, may influence breast cancer susceptibility . When incorporating KLHDC7A variants into risk assessment models, researchers should consider:

  • Integration of KLHDC7A promoter variants with established breast cancer risk loci to develop comprehensive genetic risk scores.

  • Stratification of risk models based on tumor molecular subtypes, as KLHDC7A may have subtype-specific effects.

  • Evaluation of gene-environment interactions that may modify the impact of KLHDC7A variants on cancer risk.

Research has demonstrated that the risk T-allele of rs2992756 significantly reduces KLHDC7A promoter activity in reporter assays , suggesting a potential mechanism through which this variant contributes to breast cancer risk. This functional evidence strengthens the biological plausibility of KLHDC7A's role in breast cancer etiology and highlights the importance of including functional validation when assessing novel risk loci. Future risk assessment models incorporating KLHDC7A variants should be validated across diverse populations to ensure broad applicability in clinical settings.

What methodological challenges exist in comparative studies of Kelch domain proteins across species?

  • Structural homology assessment beyond sequence similarity, as Kelch domains may form similar β-propeller structures despite sequence divergence.

  • Functional conservation testing through complementation assays, where the protein from one species is expressed in another to determine functional rescue capabilities.

  • Evolutionary context analysis, recognizing that Kelch domain proteins have diverse functions across taxa, from phosphatase activity in Plasmodium to potential roles in cancer biology in primates .

  • Methodological standardization across model systems, as experimental conditions optimized for mammalian systems may not translate to other organisms.

The unique domain architecture of Kelch-containing proteins, previously primarily described in Plantae and now identified in diverse organisms including Plasmodium , highlights the evolutionary complexity of this protein family. Research on the PPKL phosphatase demonstrates how Kelch domain proteins can serve essential functions in organism development and morphology , which may provide insights into potential conserved functions of KLHDC7A in mammals.

What are the optimal experimental designs for studying KLHDC7A protein-protein interactions?

When investigating KLHDC7A protein-protein interactions, researchers should implement a multi-faceted experimental approach that leverages the structural characteristics of Kelch domains as protein-protein interaction platforms. Based on studies of related Kelch domain-containing proteins , the following methodological framework is recommended:

  • Initial screening through affinity purification coupled with mass spectrometry (AP-MS) to identify potential interaction partners in relevant cell types expressing KLHDC7A.

  • Validation of high-confidence interactions using reciprocal co-immunoprecipitation with both endogenous and tagged proteins.

  • Domain mapping experiments utilizing truncated constructs to determine which Kelch repeats within KLHDC7A mediate specific interactions.

  • Functional validation through siRNA knockdown or CRISPR knockout of interaction partners, followed by assessment of KLHDC7A-dependent cellular processes.

  • Structural characterization using techniques such as X-ray crystallography or cryo-electron microscopy to define interaction interfaces at the molecular level.

This systematic approach enables comprehensive characterization of the KLHDC7A interactome, providing insights into its biological functions and potential roles in disease processes such as breast cancer, where KLHDC7A promoter variants have been implicated .

How can multi-omics data integration enhance understanding of KLHDC7A function?

To comprehensively characterize KLHDC7A function, researchers should implement an integrated multi-omics approach similar to methods used in p53 regulatory network analysis . This methodological framework combines:

  • Transcriptomic profiling across multiple conditions and cell types to identify genes consistently co-regulated with KLHDC7A.

  • Epigenomic mapping of chromatin accessibility and histone modifications at the KLHDC7A locus to characterize tissue-specific regulatory mechanisms.

  • Proteomic analysis to identify post-translational modifications of KLHDC7A and quantify protein interaction dynamics.

  • Functional genomics through CRISPR screens to identify genetic dependencies related to KLHDC7A function.

The integration of these data types can be achieved through computational methods similar to those used to generate p53 Expression Scores , where data synthesis across multiple studies enables identification of high-confidence functional relationships. This approach is particularly valuable for studying proteins like KLHDC7A where direct experimental evidence may be limited but can be inferred through data integration. Researchers should pay special attention to breast tissue datasets given the association of KLHDC7A variants with breast cancer risk , while also exploring other tissues to understand potential pleiotropic effects.

What are the most promising future research directions for KLHDC7A studies?

Based on current evidence and the methodological approaches discussed, several high-priority research directions for KLHDC7A can be identified:

  • Comprehensive characterization of the regulatory mechanisms controlling KLHDC7A expression, particularly focusing on the functional consequences of promoter variants like rs2992756 .

  • Exploration of KLHDC7A's potential role in breast cancer progression through mechanistic studies in appropriate cell line and animal models.

  • Investigation of evolutionary conservation of KLHDC7A function across primates and other mammals, building on established methods for evolutionary analysis of regulatory networks .

  • Development of KLHDC7A-targeted therapeutic approaches, particularly if further research confirms its role in cancer biology.

  • Integration of KLHDC7A variants into comprehensive genetic risk assessment tools that could enhance breast cancer risk prediction in clinical settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.