Recombinant Pongo abelii Leukocyte surface antigen CD47 (CD47)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific requests. Please indicate your desired format in the order notes, and we will fulfill your requirements.
Lead Time
Delivery time may vary based on the purchasing method and location. We recommend consulting your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice packaging is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We strive to accommodate specific tag type requests. If you have a preference, please specify it during your order, and we will prioritize meeting your requirements.
Synonyms
CD47; Leukocyte surface antigen CD47; Integrin-associated protein; IAP; CD antigen CD47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-323
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVP TDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFS PNENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALLVAGLIITVIVIVGAILFV PGEYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLNSFVIAILVIQVIAYILAVVGLSL CIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKG MMNDE
Uniprot No.

Target Background

Function
CD47 plays a critical role in cell adhesion, acting as an adhesion receptor for THBS1 on platelets. It is also involved in modulating integrins. CD47 is essential for memory formation and synaptic plasticity in the hippocampus. It serves as a receptor for SIRPA, binding to which prevents the maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation, and costimulates T-cell activation. CD47 may play a role in membrane transport and/or integrin-dependent signal transduction. It may also prevent premature elimination of red blood cells and could be involved in membrane permeability changes induced following virus infection.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pongo abelii Leukocyte Surface Antigen CD47 and how does it compare to human CD47?

Pongo abelii (Sumatran orangutan) Leukocyte Surface Antigen CD47 is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily. It functions as a "don't-eat-me" signal that prevents phagocytosis by binding to signal regulatory protein alpha (SIRPα) on macrophages . The protein is also known as Integrin-Associated Protein (IAP) and Protein MER6 .

Based on ortholog group data, Pongo abelii CD47 shares significant sequence homology with human CD47, as evidenced by their grouping in multiple ortholog groups with high bitscores ranging from 155 to 469, indicating strong evolutionary conservation . This conservation suggests experimental findings using the orangutan CD47 may have translational relevance to human systems.

What are the structural domains and features of CD47 relevant for experimental design?

CD47 contains a single Ig-like V-type (immunoglobulin-like) domain, which is critical for its interaction with binding partners . The typical recombinant construct of Pongo abelii CD47 used in research includes amino acids from approximately Gln4 to Glu126, representing the extracellular domain that mediates protein-protein interactions .

The protein undergoes significant post-translational modifications, particularly glycosylation, which substantially impacts its molecular weight. While the calculated molecular weight is approximately 40.5 kDa, glycosylation causes the protein to migrate at 50-66 kDa under reducing conditions and 100-130 kDa under non-reducing conditions in SDS-PAGE analysis . This glycosylation pattern is crucial to consider when designing experiments, as it affects protein interactions and function.

What molecular interactions does CD47 participate in that are significant for research applications?

CD47 engages in several key molecular interactions that make it an important research target:

  • CD47-SIRPα interaction: This is the primary "don't-eat-me" signaling mechanism. CD47 binding to SIRPα triggers phosphorylation and activation of SIRPα, which recruits and activates SHP phosphatase. This leads to dephosphorylation of myosin 2a, resulting in diminished phagocytosis of cells expressing CD47 .

  • Thrombospondin-1 (THBS1) binding: CD47 functions as an adhesion receptor for THBS1 on platelets, contributing to cell adhesion processes .

  • CD47-SIRPG interaction: This interaction mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation, and costimulates T-cell activation .

These interactions can be measured experimentally through functional ELISA assays. For example, immobilized SIRPA protein can bind human CD47 with an EC50 of 65.91-82.42 ng/ml, and LSPR (Localized Surface Plasmon Resonance) assays have demonstrated SIRPA-CD47 binding with an affinity constant of 19.1 nM .

What are the optimal methods for producing recombinant Pongo abelii CD47 for research?

Based on the literature, the most effective method for producing functional recombinant Pongo abelii CD47 involves expression in mammalian systems, particularly human 293 cells (HEK293) . This expression system ensures proper protein folding and post-translational modifications.

The recommended recombinant construct includes:

  • Expression of the extracellular domain (typically Gln4-Glu126)

  • Addition of a tag for purification and detection (commonly His-tag or Fc-tag)

  • Use of a signal peptide to ensure proper secretion

The production protocol typically involves:

  • Transfection of HEK293 cells with an optimized expression vector

  • Culture in protein-free medium to minimize contamination

  • Collection of supernatant containing the secreted protein

  • Purification using affinity chromatography (based on the protein tag)

  • Quality assessment by SDS-PAGE analysis under both reducing and non-reducing conditions

  • Endotoxin testing (should be <1.0 EU per μg by the LAL method)

How can researchers validate the functional activity of recombinant CD47 protein?

Functional validation of recombinant CD47 should include multiple complementary approaches:

  • Binding assays: Functional ELISA or SPR (Surface Plasmon Resonance) to measure binding to known interaction partners such as SIRPα. For example, immobilizing SIRPA at 2 μg/ml and measuring CD47 binding with an expected EC50 of approximately 65-82 ng/ml .

  • Cellular assays: Assess the protein's ability to inhibit macrophage-mediated phagocytosis, which is CD47's primary biological function. This can be quantified using flow cytometry-based phagocytosis assays with fluorescently labeled target cells.

  • Blocking assays: Evaluate the ability of anti-CD47 antibodies to block the CD47-SIRPα interaction in the presence of the recombinant protein. For instance, ZF1 antibody has been shown to efficiently block the physical interaction of immobilized recombinant human CD47 to human and mouse SIRPα in blocking assays in vitro .

It's important to note that biochemical assays may not always correlate perfectly with functional outcomes. For example, research has shown that while the ZF1 antibody was inferior to B6H12 in blocking CD47-SIRPα interaction in biochemical assays, it induced macrophage-mediated phagocytosis as efficiently or even more effectively than B6H12 in cellular assays .

What methodological approaches are most effective for studying CD47's role in cancer immunology?

Several methodological approaches have proven effective for investigating CD47's role in cancer immunology:

  • Expression analysis: Quantifying CD47 expression levels in cancer cells compared to normal cells using flow cytometry, immunohistochemistry, or RNA sequencing. CD47's overexpression has been documented in various malignancies, including leukemia, lymphoma, multiple myeloma, and solid tumors such as breast, colon, hepatocellular carcinoma, melanoma, and lung cancer .

  • Phagocytosis assays: These are critical for evaluating CD47's functional impact on immune evasion. Typical protocols involve:

    • Co-culture of fluorescently labeled cancer cells with macrophages

    • Treatment with CD47-blocking antibodies or recombinant SIRPα

    • Quantification of phagocytosis by flow cytometry or microscopy

    • Dose-dependent analysis (as shown with ZF1 antibody treatment)

  • Blocking antibody studies: Anti-CD47 antibodies like ZF1 have demonstrated the ability to induce efficient engulfment of leukemic cells expressing high levels of CD47 on their surface in a dose-dependent manner .

  • Antibody-drug conjugates (ADCs): Novel approaches include developing CD47-specific ADCs that combine targeting with direct cytotoxic effects, such as those using VCMMAE (Valine-Citrulline-Monomethyl Auristatin E) with anti-CD47 monoclonal antibodies for treating Non-Small Cell Lung Cancer .

How do experimental findings from Pongo abelii CD47 translate to human applications?

When considering translation from Pongo abelii CD47 to human applications, researchers should consider several factors:

  • Ortholog grouping: InParanoiDB data demonstrates that Pongo abelii CD47 (Q5REL0) groups with human CD47 in multiple ortholog groups with high bitscores (ranging from 155 to 469) and inparalog scores of 1.0, indicating strong evolutionary conservation and functional similarity .

  • Cross-species interaction: Research has shown that human CD47 can interact with both human and mouse SIRPα, suggesting conservation of binding interfaces across species . Similar cross-reactivity may exist between Pongo abelii CD47 and human SIRPα, though this should be experimentally verified.

  • Structural differences: Despite high conservation, species-specific differences in glycosylation patterns or subtle amino acid variations may affect binding affinity or pharmacokinetics of targeting agents.

The experimental design should include:

  • Side-by-side comparison of Pongo abelii and human CD47 in key functional assays

  • Validation of critical findings with human CD47 before clinical translation

  • Analysis of species-specific post-translational modifications that might affect function

What are the methodological challenges in studying CD47-targeting therapeutics and how can they be addressed?

Researchers face several methodological challenges when studying CD47-targeting therapeutics:

How can researchers effectively investigate CD47's interactions with SIRPα and other binding partners?

To effectively investigate CD47's interactions with SIRPα and other binding partners, researchers should employ multiple complementary approaches:

  • Binding assays:

    • ELISA-based binding assays (as demonstrated with immobilized SIRPA binding to human CD47 with an EC50 of 65.91-82.42 ng/ml)

    • Surface Plasmon Resonance (SPR) or LSPR (Localized Surface Plasmon Resonance) for real-time binding kinetics (SIRPA-CD47 binding has been measured with an affinity constant of 19.1 nM)

    • Bio-Layer Interferometry (BLI) for analyzing binding kinetics without label requirements

  • Blocking assays:

    • Using recombinant proteins to measure competitive binding

    • Testing antibodies for their ability to disrupt CD47-SIRPα interactions

    • Comparing blocking efficiency across species (human and mouse SIRPα)

  • Structural studies:

    • X-ray crystallography of CD47-SIRPα complexes

    • Cryo-EM analysis of larger protein complexes

    • Computational modeling to predict binding interfaces and the impact of mutations

  • Cellular validation:

    • Phagocytosis assays with primary macrophages

    • CRISPR-mediated knockout/knockin studies to assess specificity

    • Domain swap or mutagenesis studies to identify critical binding residues

How should researchers interpret contradictory data regarding CD47 function in different experimental systems?

When faced with contradictory data regarding CD47 function across different experimental systems, researchers should:

What quantitative methods provide the most reliable assessment of CD47 expression and function?

The most reliable quantitative methods for assessing CD47 expression and function include:

  • Expression quantification:

    • Flow cytometry with calibrated standards for absolute quantification

    • Quantitative proteomics using stable isotope labeling

    • Digital PCR for absolute transcript quantification

    • Western blotting with recombinant protein standards for relative quantification

  • Functional assessment:

    • Phagocytosis index calculation: (% of macrophages with ingested target cells × mean number of target cells per macrophage)

    • Live cell imaging with automated image analysis to track phagocytic events over time

    • Competitive binding assays with defined kinetic parameters (kon, koff, KD)

  • Data analysis approaches:

    • Multiparameter analysis correlating CD47 expression with functional outcomes

    • Machine learning algorithms to identify patterns in complex datasets

    • Statistical methods that account for biological variability

For example, when evaluating anti-CD47 antibodies like ZF1, researchers should quantify phagocytosis in dose-dependent assays, as demonstrated in studies showing efficient engulfment of leukemic cells expressing high levels of CD47 .

What emerging methodologies show promise for advancing CD47 research?

Several emerging methodologies show significant promise for advancing CD47 research:

  • Novel therapeutic approaches:

    • CD47-specific Antibody-Drug Conjugates (ADCs): Combining VCMMAE with anti-CD47 monoclonal antibodies has shown promise for direct killing of Non-Small Cell Lung Cancer cells

    • Bispecific antibodies targeting both CD47 and tumor-specific antigens to improve selectivity

    • Nano-antibody and single-domain antibody development for improved tissue penetration

  • Advanced imaging techniques:

    • Intravital microscopy to visualize CD47-mediated phagocytosis in vivo

    • Super-resolution microscopy to analyze CD47 clustering and membrane organization

    • Correlative light and electron microscopy to study CD47 at the immunological synapse

  • Systems biology approaches:

    • Multi-omics integration to understand CD47 in the context of broader signaling networks

    • CRISPR screens to identify novel regulators of CD47 expression and function

    • Single-cell analysis to capture heterogeneity in CD47 expression and response to targeting

  • Translational methodologies:

    • Development of companion diagnostics to identify patients likely to respond to CD47-targeting therapies

    • Liquid biopsy approaches to monitor CD47 expression during treatment

    • Patient-derived xenograft models to predict clinical responses

How can researchers address potential off-target effects in CD47-targeting experimental therapeutics?

To address potential off-target effects in CD47-targeting experimental therapeutics, researchers should implement:

  • Targeting strategy refinement:

    • Develop bispecific antibodies requiring dual-antigen recognition for activation

    • Engineer antibodies with optimized Fc regions to minimize unwanted effector functions

    • Create conditionally active antibodies that become functional only in the tumor microenvironment

  • Comprehensive toxicity assessment:

    • In vitro toxicity screening against panels of normal human cells

    • Ex vivo testing using human blood samples to assess hematological toxicity

    • Toxicity studies in relevant animal models with cross-reactive antibodies

  • Precision delivery approaches:

    • Local administration strategies to limit systemic exposure

    • Nanoparticle-based delivery to enhance tumor targeting

    • Photodynamic or ultrasound-activated therapies for site-specific activation

  • Combinatorial approaches:

    • Lower doses of CD47-targeting agents combined with other immunotherapies

    • Sequential treatment strategies to minimize overlapping toxicities

    • Personalized combination therapies based on individual tumor expression profiles

These methodological approaches can help researchers develop safer and more effective CD47-targeting therapeutics while minimizing potential off-target effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.