Recombinant Pongo abelii Lysosomal-associated transmembrane protein 4A (LAPTM4A)

What is the basic structural composition of LAPTM4A in Pongo abelii?

LAPTM4A in Pongo abelii (Sumatran orangutan) is a transmembrane protein consisting of 233 amino acids with a specific sequence beginning with MVSMSFKRNRSDRFYSTR and ending with FEAPPQYVLPTYEMAVKMPEKEPPPPYLPA. The protein contains four putative membrane-spanning domains and a 55 amino acid C-terminal region that faces the cytoplasm . This structural composition is crucial for its function in lysosomes and endosomes. Unlike many other transmembrane proteins, LAPTM4A demonstrates a unique requirement for two tandemly arranged tyrosine-containing motifs in its cytoplasmic domain, which are essential for its efficient localization to vesicles containing lysosomal markers .

How should recombinant LAPTM4A be stored and handled for optimal experimental results?

For optimal experimental results, recombinant LAPTM4A should be stored at -20°C, and for extended storage periods, it should be kept at -20°C or -80°C. The protein is typically supplied in a Tris-based buffer with 50% glycerol, which has been optimized for protein stability . Researchers should avoid repeated freezing and thawing cycles, as this can lead to protein degradation and functional loss. For ongoing experiments, working aliquots can be stored at 4°C for up to one week . When planning experiments, consider that the typical recommended quantity is 50 μg, though other quantities may be available depending on experimental requirements.

What are the primary functions of LAPTM4A in cellular physiology?

LAPTM4A serves multiple crucial functions in cellular physiology. Primarily, it regulates the intracellular compartmentalization of amphipathic solutes and potentially modulates cell sensitivity toward various compounds including anthracyclines, antibiotics, ionophores, nucleobases, and organic cations . This functional profile bears similarity to the multidrug-resistance phenotype exhibited by cells synthesizing high levels of P-glycoprotein. LAPTM4A's localization to endosomes and lysosomes is tightly controlled, as evidenced by the fact that even transient high-level expression in cultured cells results in no detectable protein on the cell surface . This strict localization control suggests that LAPTM4A plays a specific and regulated role in vesicular trafficking and lysosomal function.

What is the significance of the dual tyrosine-containing motifs in LAPTM4A's cytoplasmic domain?

The dual tyrosine-containing motifs in LAPTM4A's cytoplasmic domain represent a unique structural feature with significant functional implications. Unlike other membrane proteins that localize to endosomes/lysosomes through independently functioning sorting signals, LAPTM4A requires both tandemly arranged tyrosine-based sorting signals for efficient localization to vesicles containing lysosomal markers such as lysosomal glycoprotein 120 . This requirement suggests a cooperative mechanism between these motifs that enhances sorting efficiency. Mutagenic analysis of the C-terminus has demonstrated that alterations to either of these motifs significantly impair LAPTM4A's localization capacity, suggesting a potential "dual-key" mechanism for proper trafficking. This characteristic makes LAPTM4A a valuable model for studying complex protein trafficking mechanisms and could inform the development of targeted interventions that modulate its localization for therapeutic purposes.

How does LAPTM4A interact with other proteins in lysosomal and endosomal pathways?

LAPTM4A engages in multiple protein-protein interactions within lysosomal and endosomal pathways, notably with MCOLN1 and IGF2BP3, as revealed through protein interaction analysis . Advanced structural studies utilizing the Protein Data Bank and AlphaFold Protein Structure Database have provided insights into these interactions. Specifically, MCOLN1 (PDB ID: 5TJA) and IGF2BP3 (PDB ID: 6FQ1) demonstrate significant docking patterns with LAPTM4A (ID: AF-Q15012-F1) . These interactions likely facilitate LAPTM4A's role in vesicular trafficking and solute compartmentalization. Furthermore, the GeneMANIA database has identified additional functional network partners that participate in coordinated cellular activities. These protein-protein interactions not only enhance our understanding of LAPTM4A's functional role but also highlight potential targets for intervention in pathological conditions where LAPTM4A is dysregulated.

What experimental approaches can differentiate between the various functional domains of LAPTM4A?

To differentiate between LAPTM4A's functional domains, researchers can employ several sophisticated experimental approaches:

These approaches should be combined with high-resolution imaging techniques such as super-resolution microscopy to visualize the subcellular localization of wild-type versus mutant LAPTM4A variants. Additionally, employing proteomic approaches to identify domain-specific interacting partners can provide insights into the functional significance of each domain .

How is LAPTM4A expression correlated with glioma progression and patient outcomes?

LAPTM4A expression shows a strong positive correlation with glioma progression and adverse patient outcomes. Analysis of TCGA and GTEx datasets reveals significantly elevated LAPTM4A expression in low-grade glioma (LGG), glioblastoma (GBM), and combined GBMLGG samples compared to normal brain tissue . This upregulation correlates with advanced WHO grades, with expression increasing progressively from grade II to grade IV tumors. Furthermore, LAPTM4A expression is significantly higher in IDH wild-type cases compared to IDH mutant cases, and in 1p19q non-co-deletion versus co-deletion specimens .

Survival analysis using Kaplan-Meier methods and multivariate COX regression demonstrates that high LAPTM4A expression independently predicts poor prognosis in glioma patients. The protein exhibits an impressive Area Under ROC Curve (AUC) value, emphasizing its potential as a prognostic biomarker . These findings collectively establish LAPTM4A as a robust indicator of glioma progression and patient survival, suggesting its potential utility in clinical risk stratification and treatment planning.

What mechanisms underlie LAPTM4A's role in cancer metastasis and progression?

LAPTM4A contributes to cancer metastasis and progression through multiple mechanisms, with the epithelial-mesenchymal transition (EMT) pathway playing a central role. In vitro experiments have demonstrated that LAPTM4A modulates EMT in glioma cells, thereby enhancing their migratory and invasive capabilities . At the molecular level, LAPTM4A appears to influence the expression of key EMT markers and regulators, potentially through interactions with signaling pathways that control cellular plasticity.

Additionally, the recently uncovered FGD5-AS1-hsa-miR-103a-3p-LAPTM4A axis highlights LAPTM4A's involvement in complex regulatory networks that facilitate glioma progression . This ceRNA network suggests that LAPTM4A expression is regulated by upstream non-coding RNAs, which could be targeted for therapeutic intervention. Furthermore, LAPTM4A's association with the tumor microenvironment (TME) indicates its potential influence on the surrounding stromal and immune cells, creating a more permissive environment for tumor growth and dissemination .

How does LAPTM4A expression influence response to chemotherapy and immunotherapy in cancer patients?

LAPTM4A expression significantly impacts therapeutic responses in cancer patients, particularly regarding chemotherapy and immunotherapy. Drug sensitivity analysis reveals that patients with high LAPTM4A expression demonstrate increased sensitivity to doxorubicin, which notably contributes to a subsequent reduction in LAPTM4A expression levels . This creates a potentially beneficial feedback mechanism where the drug both targets the cancer cells and reduces the expression of a protein associated with poor prognosis.

Regarding immunotherapy, high LAPTM4A expression correlates with upregulation of multiple immune checkpoint genes, including PDCD1LG2, CD274, and HAVCR2 . Furthermore, using the Tumor Immune Dysfunction and Exclusion (TIDE) algorithm, patients with elevated LAPTM4A expression exhibit higher TIDE scores, indicating a diminished response to immune checkpoint blockade (ICB) therapy and potentially shorter survival following such treatment . This suggests that LAPTM4A serves as a risk factor for immunotherapy resistance. Consequently, downregulation of LAPTM4A expression may enhance the efficacy of immunotherapy in glioma patients, pointing to a potential combination strategy of LAPTM4A inhibition alongside ICB therapy .

What are the optimal techniques for evaluating LAPTM4A localization in different cellular compartments?

For precise evaluation of LAPTM4A localization across cellular compartments, researchers should employ a multi-faceted approach:

• Confocal microscopy using fluorescently tagged LAPTM4A constructs co-stained with compartment-specific markers (e.g., LAMP1 for lysosomes, Rab5 for early endosomes) provides high-resolution spatial information. Z-stack imaging should be performed to capture the full three-dimensional distribution.

• Subcellular fractionation followed by Western blotting allows quantitative assessment of LAPTM4A distribution across isolated organelle fractions. This should be performed with ultracentrifugation-based density gradient separation to achieve pure fractions .

• Proximity labeling methods such as BioID or APEX2 can identify proteins in close proximity to LAPTM4A in different compartments, providing functional context to localization data.

• Live-cell imaging using pH-sensitive fluorescent tags can distinguish between acidic (lysosomal) and neutral (cytoplasmic, ER) environments where LAPTM4A may reside.

For reliable results, researchers should validate localization using multiple techniques and include appropriate controls for each cellular compartment marker. When analyzing mutant forms of LAPTM4A (particularly those affecting the tyrosine-containing motifs), comparative analysis with wild-type protein should be conducted under identical conditions .

How can researchers effectively design experiments to investigate LAPTM4A's role in drug resistance mechanisms?

To effectively investigate LAPTM4A's role in drug resistance mechanisms, researchers should implement a comprehensive experimental design that includes:

• Generation of cell lines with varying LAPTM4A expression levels through stable overexpression, shRNA/siRNA knockdown, or CRISPR-Cas9 deletion. This creates a spectrum of models to evaluate dose-dependent effects.

• Drug sensitivity assays using a panel of chemotherapeutic agents, particularly anthracyclines, with dose-response curves to calculate IC50 values. The CGP2016 database can guide initial drug selection, with particular attention to doxorubicin which has demonstrated interaction with LAPTM4A expression .

• Time-course studies to monitor changes in LAPTM4A expression following drug treatment, using both protein (Western blot) and mRNA (qRT-PCR) quantification.

• Mechanistic investigations examining:

  • Drug accumulation and efflux rates using fluorescent drug analogs

  • Changes in lysosomal composition and pH following LAPTM4A modulation

  • Alterations in drug target interactions

  • Cell death pathway activation (apoptosis, necrosis, autophagy)

• In vivo validation using xenograft models with manipulated LAPTM4A expression to confirm findings from cell culture systems.

Data should be analyzed using appropriate statistical methods, including two-way ANOVA to account for both drug concentration and LAPTM4A expression levels as variables .

What methodologies are recommended for studying LAPTM4A's interaction with the immune microenvironment?

For comprehensive investigation of LAPTM4A's interactions with the immune microenvironment, researchers should employ these methodological approaches:

• Single-cell RNA sequencing (scRNA-seq) analysis using platforms like TISCH to examine cell type-specific expression of LAPTM4A within the tumor microenvironment. This allows quantification and visualization of LAPTM4A expression across diverse immune and stromal cell populations .

• Immune cell infiltration analysis using computational tools like TIMER2 to investigate relationships between LAPTM4A expression and 12 immune cell subgroups, including cancer-associated fibroblasts (CAFs), regulatory T cells (Tregs), macrophages, and monocytes .

• Co-culture systems combining LAPTM4A-modified tumor cells with immune cell populations to assess:

  • Changes in immune cell recruitment and activation

  • Cytokine/chemokine production profiles

  • Immune checkpoint molecule expression

  • Functional immune cell responses (cytotoxicity, phagocytosis)

• Multiplex immunohistochemistry or flow cytometry to characterize immune cell populations in LAPTM4A-high versus LAPTM4A-low tumors, focusing on markers of immune activation and exhaustion.

• In vivo immune checkpoint inhibitor response studies in models with modulated LAPTM4A expression, with subsequent analysis using the TIDE algorithm to predict and validate treatment outcomes .

For data interpretation, correlation analyses should examine associations between LAPTM4A expression and immune cell markers, chemokine/chemokine receptor levels, and checkpoint molecule expression using appropriate statistical methods .

What are the most promising therapeutic approaches targeting LAPTM4A in cancer treatment?

Several therapeutic approaches targeting LAPTM4A show significant promise for cancer treatment:

• Small molecule inhibitors: Development of compounds that specifically target LAPTM4A's functional domains, particularly those involved in solute transport or trafficking. The established sensitivity of high-LAPTM4A tumors to doxorubicin provides a foundation for combination therapeutic strategies .

• RNA interference therapeutics: siRNA or antisense oligonucleotides designed to downregulate LAPTM4A expression, potentially enhancing both conventional chemotherapy and immunotherapy responses. The recently identified FGD5-AS1-hsa-miR-103a-3p-LAPTM4A axis offers multiple intervention points within this regulatory network .

• Immunotherapy combinations: Given LAPTM4A's correlation with immune checkpoint gene expression and TIDE scores, combining LAPTM4A inhibition with immune checkpoint blockade may overcome resistance mechanisms and enhance treatment efficacy .

• Antibody-drug conjugates: Development of antibodies targeting the extracellular domains of LAPTM4A, conjugated to cytotoxic agents for targeted delivery to LAPTM4A-overexpressing cancer cells.

• Lysosomal-targeting strategies: Since LAPTM4A is involved in lysosomal function, compounds that accumulate in lysosomes and interfere with LAPTM4A-dependent processes could provide selective targeting of cancer cells with elevated LAPTM4A expression.

Future therapeutic development should focus on target specificity to minimize off-target effects and consider the unique structural features of LAPTM4A, particularly its tyrosine-containing motifs essential for proper localization .

How might evolutionary conservation of LAPTM4A across species inform our understanding of its fundamental biological functions?

The evolutionary conservation of LAPTM4A across mammals, insects, and nematodes offers valuable insights into its fundamental biological functions:

• Sequence analysis across species reveals highly conserved domains that likely represent functionally critical regions. Comparing Pongo abelii LAPTM4A (UniProt: Q5RAH0) with orthologs across species can identify invariant residues essential for core functions .

• The preservation of LAPTM4A's four-transmembrane domain structure and C-terminal tyrosine-containing motifs across diverse species suggests these features evolved early and serve evolutionarily advantageous functions, likely related to endolysosomal trafficking or membrane transport .

• Functional studies in model organisms at different evolutionary distances from humans (e.g., C. elegans, Drosophila, zebrafish, mice) can reveal conserved versus species-specific roles. This comparative approach may uncover LAPTM4A functions that predate its involvement in cancer-related processes.

• Analysis of expression patterns across tissues in different species may highlight conserved regulatory mechanisms and tissue-specific functions that have been maintained throughout evolution.

• Studying natural variants of LAPTM4A across species that have adapted to different environmental conditions could provide insights into functional plasticity and potential compensatory mechanisms that might be exploited therapeutically.

This evolutionary perspective can guide the identification of functionally critical domains for therapeutic targeting while predicting potential off-target effects in conserved pathways .

What novel techniques could advance our understanding of LAPTM4A's role in cellular homeostasis and disease states?

Emerging techniques offer significant potential to advance our understanding of LAPTM4A:

• CRISPR-based genetic screens: Genome-wide or targeted CRISPR screens can identify synthetic lethal interactions with LAPTM4A manipulation, revealing context-dependent vulnerabilities in cancer cells and potential combination therapeutic targets.

• Spatial proteomics and interactomics: Technologies like proximity-dependent biotin identification (BioID) or APEX2 can map LAPTM4A's protein interactions within specific subcellular compartments, providing spatial resolution to its functional networks .

• Advanced imaging approaches:

  • Correlative light and electron microscopy (CLEM) to visualize LAPTM4A at ultrastructural resolution

  • Super-resolution microscopy techniques like STORM or PALM to capture dynamic LAPTM4A trafficking

  • Label-free imaging methods to study LAPTM4A in native contexts without potential artifacts from tags

• Organoid and patient-derived xenograft models: These systems better recapitulate the complexity of human tumors and can validate findings from cell line studies in more physiologically relevant contexts.

• Single-cell multi-omics approaches: Integrating scRNA-seq with spatial transcriptomics, proteomics, and metabolomics at single-cell resolution can provide comprehensive understanding of LAPTM4A's role in heterogeneous tumor populations .

• Machine learning and AI approaches: Leveraging computational methods to integrate diverse datasets and predict LAPTM4A functions, interactions, and potential targeting strategies based on structural features and expression patterns.

These techniques, particularly when used in combination, promise to resolve current knowledge gaps and accelerate translational applications of LAPTM4A research .