Recombinant Pongo abelii Magnesium transporter MRS2 homolog, mitochondrial (MRS2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MRS2; MRS2L; Magnesium transporter MRS2 homolog, mitochondrial; MRS2-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
50-443
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
MRS2
Target Protein Sequence
RAAQLCEPGRLRVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFERKKTELYQ ELGLQARDLRFQHVMSITVRNNRIIMRMEYLKAVITPECLLILDYRNLNLEQWLFRELPS QLSGEGQLVTYPLPFEFRAIEALLQYWINTLQGKLSVLQPLILETLDALVDPKHSSVDKS KLHILLQNGKSLSELETDIKIFKESILEILDEEELLEELCVSKWSDPQVFEKSSAGIDHA EEMELLLENYYRLADDLSNAARELRVLIDDSQSIIFINLGSHRNVMMRLNLQLTMGTFSL SLFGLMGVAFGMNLESSLEEDHRIFWLITGIMFMGSGLIWRRLLSFLGRQLEAPLPPMMA SLPKKTLLADRSMELKNSLRLDGLGSGRSILTNR
Uniprot No.

Target Background

Function
A mitochondrial magnesium transporter mediating magnesium influx into the mitochondrial matrix. It is essential for the normal expression of mitochondrial respiratory complex I subunits.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of MRS2 protein in Pongo abelii?

The Pongo abelii MRS2 protein possesses a distinct structural arrangement consisting of multiple domains with specific functions. The mature protein includes a large amino terminal domain (NTD) positioned within the mitochondrial matrix, corresponding to residues 58-333 and comprising approximately 71% of the mature polypeptide chain . This NTD is followed by two transmembrane domains (TM1 and TM2) connected by a highly conserved intermembrane space loop, and finally a smaller carboxyl terminal domain also oriented within the mitochondrial matrix . The protein contains the characteristic Gly-Met-Asn (GMN) motif at the end of the first transmembrane helix, which is essential for magnesium transport function and is highly conserved across the CorA/Mrs2/Alr1 protein superfamily . The full amino acid sequence reveals a protein rich in charged amino acids that facilitate ion interactions and transport mechanisms necessary for proper mitochondrial function .

How does MRS2 function as a magnesium transporter in mitochondria?

MRS2 functions as a high-conductance magnesium-selective channel that regulates magnesium influx into mitochondria through an intrinsic negative feedback mechanism. Single-channel patch clamping studies have unequivocally demonstrated that the mitochondrial MRS2 protein forms a magnesium-selective channel with a remarkably high conductance of approximately 155 pS . This channel exhibits an open probability of roughly 60% in the absence of magnesium at the matrix site, which decreases significantly to approximately 20% when magnesium is present, demonstrating a regulatory feedback mechanism . Although primarily selective for magnesium, the MRS2 channel can also transport nickel ions with a lower conductance of approximately 45 pS, while showing no permeability for calcium, manganese, or cobalt ions . Cryo-electron microscopy structures reveal that MRS2 assembles into a pentameric channel architecture, creating a pore through which magnesium ions can permeate the inner mitochondrial membrane, thus playing a crucial role in maintaining appropriate magnesium concentrations essential for numerous mitochondrial metabolic functions .

What techniques are used to study recombinant MRS2 protein functionality?

The study of recombinant MRS2 protein functionality employs a diverse array of complementary techniques that provide comprehensive insights into its structure and function. Electrophysiological analyses, particularly single-channel patch clamping, have been instrumental in characterizing MRS2 as a high-conductance magnesium-selective channel, enabling precise measurements of ion permeability, conductance values, and open probability under various conditions . Cryo-electron microscopy has revolutionized structural understanding of MRS2, revealing its pentameric channel architecture and providing molecular insights into ion permeation mechanisms and potential regulatory pathways . Light scattering and chromatographic approaches are utilized to investigate the protein's oligomerization states and the effects of different divalent cations on its assembly and stability . Additionally, researchers employ recombinant protein expression systems to produce sufficient quantities of purified MRS2 for experimental analysis, often incorporating tags for purification while maintaining the protein in appropriate buffer conditions to preserve native structure and function . These multidisciplinary approaches collectively enable researchers to elucidate the complex relationship between MRS2's structure and its critical role in mitochondrial magnesium homeostasis.

How does the amino terminal domain (NTD) of MRS2 regulate channel activity?

The amino terminal domain of MRS2 plays a sophisticated regulatory role in channel activity through divalent cation-induced structural changes and oligomerization dynamics. Research has revealed that the human MRS2 NTD self-associates into a homodimer under dilute conditions when divalent cations are absent, contrasting with the pentameric assembly observed in CorA, its bacterial ortholog . This structural arrangement is significantly altered by specific divalent cations, with both magnesium and calcium suppressing the self-association of the domain, while cobalt has no effect on the NTD oligomerization . Interestingly, cobalt instead disassembles full-length MRS2, revealing a domain-specific sensitivity to different divalent cations . The binding of magnesium to the NTD triggers significant conformational changes affecting secondary, tertiary, and quaternary protein structure, suggesting that magnesium binding to the NTD disrupts homomeric interactions and inhibits mitochondrial magnesium uptake as a negative feedback mechanism . This regulatory mechanism appears fundamental to maintaining appropriate mitochondrial magnesium levels, as mutations in key residues mediating magnesium binding to the NTD not only decrease magnesium-binding affinity approximately sevenfold but also eliminate the structural changes normally induced by magnesium binding .

How do mutations in MRS2 affect mitochondrial function and disease pathology?

Mutations in the MRS2 gene produce profound effects on mitochondrial function that can manifest as serious pathological conditions affecting multiple organ systems. In animal models, the Mrs2dmy mutant rat develops a striking demyelinating phenotype characterized by elevated lactic acid in cerebrospinal fluid, reduced ATP in the brain, increased cytochrome c oxidase (COX) activity, and morphological alterations of mitochondria – all hallmarks of classical mitochondrial diseases . The link between MRS2 dysfunction and demyelination suggests a particular vulnerability of myelinating cells to disruptions in mitochondrial magnesium homeostasis, potentially due to their high energy requirements . At the molecular level, MRS2 knock-down experiments in human HEK-293 cells have demonstrated a cascade of physiological changes ranging from transient reduction of magnesium uptake to complete loss of mitochondrial respiratory complex I, decreased mitochondrial membrane potential, and ultimately cell death, with severity depending on knock-down duration . Mutations affecting the highly conserved Gly-Met-Asn (GMN) motif either completely abolish magnesium transport or profoundly alter the ion selectivity of the channel, underscoring this region's critical functional importance . The consequences of MRS2 mutations appear to be tissue-specific, with high-energy-demanding tissues like brain, peripheral nerves, and skeletal muscles showing particular vulnerability, consistent with patterns observed in other mitochondrial diseases including Leigh syndrome and mitochondrial DNA depletion syndrome .

What are the optimal conditions for expressing and purifying recombinant MRS2 protein?

The successful expression and purification of recombinant MRS2 protein requires careful optimization of multiple parameters to maintain structural integrity and functional activity. When expressing Pongo abelii MRS2, researchers typically utilize eukaryotic expression systems that can properly process mitochondrial proteins, with the protein often being expressed with purification tags that are determined during the production process based on optimal expression and folding characteristics . Purified recombinant MRS2 is typically stored in a Tris-based buffer supplemented with 50% glycerol, which has been optimized specifically for this protein to maintain stability and prevent aggregation during storage . Temperature control is critical during both expression and storage, with extended storage requiring temperatures of -20°C or -80°C to preserve protein integrity, while working aliquots can be maintained at 4°C for up to one week . To avoid protein degradation due to freeze-thaw cycles, repeated freezing and thawing is not recommended, as this can lead to denaturation and loss of functional activity . When designing expression constructs, careful consideration must be given to the expression region, with the functional domain of Pongo abelii MRS2 typically encompassing residues 50-443, though specific experimental goals may require expression of particular domains such as the amino terminal domain (residues 58-333) for regulatory studies .

What analytical techniques are most effective for studying MRS2 channel activity?

Comprehensive investigation of MRS2 channel activity requires a multifaceted methodological approach combining electrophysiological, structural, and biochemical techniques. Patch-clamp electrophysiology stands as the gold standard for directly measuring MRS2 channel conductance properties, with single-channel recordings providing unparalleled insights into the channel's conductance (155 pS for magnesium), ion selectivity, and open probability under varying ionic conditions . Complementing these functional studies, cryo-electron microscopy has emerged as a powerful tool for revealing the structural basis of MRS2 channel activity, with recent studies yielding multiple reconstructions of human MRS2 under various conditions that illuminate the pentameric assembly and ion permeation pathways . For investigating the regulatory dynamics of MRS2, researchers employ light scattering techniques to monitor oligomerization states in response to different divalent cations, while circular dichroism spectroscopy can detect conformational changes in secondary structure elements upon ligand binding . Mutagenesis studies targeting key residues, particularly within the conserved GMN motif and putative divalent cation binding sites, provide critical insights into structure-function relationships, with functional consequences assessed using mitochondrial magnesium uptake assays in cellular systems . Mitochondrial function assays measuring ATP production, membrane potential, and respiratory complex activity serve as downstream readouts of MRS2 channel functionality, connecting molecular mechanisms to organelle-level physiology .

How can researchers differentiate between the effects of various divalent cations on MRS2 structure and function?

Researchers employ a sophisticated toolkit of complementary methodologies to distinguish the differential effects of various divalent cations on MRS2 structure and function with high precision. Dynamic light scattering and size-exclusion chromatography provide valuable insights into the oligomerization states of MRS2 in response to different divalent cations, revealing that magnesium and calcium suppress self-association of the amino terminal domain, while cobalt specifically disassembles full-length MRS2 without affecting the NTD . These observations are further validated through quantitative analysis of hydrodynamic radius distributions, where regularization/polydisperse deconvolution and cumulative deconvolution techniques extract weight-averaged hydrodynamic radii from autocorrelation functions, confirming domain-specific sensitivity to different divalent cations . Electrophysiological methods allow direct measurement of ion permeation, demonstrating that while MRS2 primarily conducts magnesium ions (155 pS), it can also transport nickel with lower conductance (approximately 45 pS) but shows no permeability for calcium, manganese, or cobalt ions . Recent cryo-electron microscopy studies under various ionic conditions have revealed the structural basis for these functional differences, showing how the pentameric channel architecture responds to different ions . For the most comprehensive understanding, researchers often combine these approaches with isothermal titration calorimetry to measure binding affinities of different divalent cations, and mutagenesis studies targeting putative ion-binding sites to confirm the molecular determinants of ion selectivity and regulatory mechanisms .

What are the key structural parameters and functional properties of MRS2 across species?

The structural parameters and functional properties of MRS2 demonstrate both conservation and divergence across species, reflecting evolutionary adaptations while maintaining essential magnesium transport capability. The table below summarizes key comparative features:

SpeciesOligomeric StateChannel ConductanceIon SelectivityKey Regulatory FeaturesNTD Size (approx.)
Human (Homo sapiens)PentamerNot fully characterizedMg²⁺, Ca²⁺, Na⁺, K⁺Ca²⁺-regulatedResidues 58-333 (≈71% of protein)
Yeast (S. cerevisiae)PentamerNot fully characterizedPrimarily Mg²⁺Similar to humanSmaller than human
Bacteria (CorA)PentamerVariableMg²⁺Mg²⁺-gatedStructurally distinct from eukaryotic
Rat (Mrs2dmy mutant)Presumed pentamerReduced functionAlteredAssociated with demyelinationSimilar to human
Sumatran orangutan (Pongo abelii)Presumed pentamerNot characterizedPresumed Mg²⁺ selectivePresumed similar to humanResidues 50-443 for full mature protein

How does recombinant MRS2 protein aid in studying mitochondrial diseases?

Recombinant MRS2 protein serves as an invaluable research tool for investigating mitochondrial diseases, providing multiple experimental avenues for understanding pathological mechanisms and developing therapeutic strategies. The table below outlines key applications:

Research ApplicationMethodologyInsights ProvidedRelevance to Disease
Structure-function analysisCryo-EM with recombinant proteinsMolecular basis of ion permeationUnderstanding pathogenic mutations
Mutation screeningSite-directed mutagenesis of recombinant MRS2Effects of patient-derived mutationsGenotype-phenotype correlations
Drug discoveryIn vitro binding assays with purified proteinIdentification of small molecule modulatorsTherapeutic development
Biophysical characterizationPatch-clamp with reconstituted channelsChannel kinetics and regulationMechanism-based interventions
Protein-protein interactionsPull-down assays with tagged recombinant proteinIdentification of interaction partnersPathway analysis

The Mrs2dmy mutant rat model has demonstrated that MRS2 dysfunction can lead to a demyelinating syndrome with characteristics of mitochondrial disease, including elevated lactic acid in cerebrospinal fluid, reduced ATP in the brain, increased cytochrome c oxidase activity, and morphological alterations of mitochondria . This association between MRS2 dysfunction and demyelination offers a valuable model for investigating mitochondrial diseases with neurological manifestations, such as Leigh syndrome and mitochondrial DNA depletion syndrome, which frequently affect tissues with high energy demands like the cerebrum, peripheral nerves, and skeletal muscles . Research using recombinant MRS2 has revealed that mutations in key domains can either abolish magnesium transport completely or alter its regulatory characteristics toward more open and partly deregulated states, providing molecular insights into how genetic variants might contribute to disease pathology . By allowing detailed investigation of structure-function relationships, recombinant MRS2 enables researchers to better understand the molecular mechanisms underlying mitochondrial magnesium homeostasis and its disruption in disease states, potentially leading to novel therapeutic approaches for mitochondrial disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.