Recombinant Pongo abelii Magnesium transporter protein 1 (MAGT1)

Shipped with Ice Packs
In Stock

Description

Product Overview

Recombinant MAGT1 from Pongo abelii (Sumatran orangutan) is produced in E. coli with an N-terminal His tag for purification and detection. Key specifications include:

PropertyDetails
UniProt IDQ5RE31
Expression SystemEscherichia coli
Protein Length30–335 amino acids (mature protein)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for storage

This recombinant protein avoids post-translational modifications, making it ideal for structural and functional studies .

Functional Domains

  • Transmembrane domains: Critical for Mg²⁺ transport .

  • OST3/OST6 homology: Associates with the oligosaccharyltransferase (OST) complex for N-linked glycosylation .

In Vitro Studies

  • Magnesium Transport: MAGT1 facilitates Mg²⁺ uptake in epithelial cells, with activity sensitive to extracellular Mg²⁺ levels .

  • Glycosylation Role: Integrates into the OST complex to glycosylate immune proteins (e.g., NKG2D, CD28), crucial for T-cell and NK-cell function .

In Vivo Implications

  • XMEN Disease: Loss-of-function mutations cause X-linked immunodeficiency with Epstein-Barr virus susceptibility and neoplasia. Defective MAGT1 disrupts glycosylation of NKG2D, impairing antiviral immunity .

  • B-Cell Dysregulation: Magt1⁻/ʸ mice show altered Mg²⁺/Ca²⁺ homeostasis, leading to aberrant B-cell development and hyperactive BCR signaling .

Therapeutic Potential

  • Gene Therapy: CRISPR-targeted MAGT1 insertion restores NKG2D expression and lymphocyte function in XMEN patient cells, demonstrating curative potential .

Comparative Analysis: Human vs. Pongo abelii MAGT1

FeatureHuman MAGT1Pongo abelii MAGT1
Gene LocationXq21.1Ortholog on X chromosome
Protein Length335 aa335 aa
Glycosylation RoleCritical for CD28/NKG2DConserved OST interaction
Immune RelevanceXMEN disease pathogenesisModel for human studies

Applications in Research

  • Immune Dysfunction Studies: Used to model XMEN disease and investigate glycosylation defects .

  • Cation Transport Assays: Quantify Mg²⁺ flux in transfected cell lines .

  • Structural Biology: Crystallization trials to resolve transmembrane domain architecture .

Key Challenges and Future Directions

  • Functional Redundancy: Partial compensation by paralog TUSC3 complicates phenotype interpretation .

  • Therapeutic Optimization: Improve CRISPR-AAV delivery efficiency for clinical translation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific requirements. Please indicate your preferred format in the order notes, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are sent with standard blue ice packs. If dry ice shipping is required, please communicate your request in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C. Lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MAGT1; IAG2; Magnesium transporter protein 1; MagT1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1; Oligosaccharyl transferase subunit MAGT1; Implantation-associated protein; IAP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-335
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
MAGT1
Target Protein Sequence
QRKKEMVLSEKVCQLMEWTNKRPVIRMNGDKFRRLVKAPPRNYSVIVMFTALQLHRQCVV CKQADEEFQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPK RGDTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSN MEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAET HIVLLFNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIGLVVLFFSWMLSIFRSKYHGYP YSFLMS
Uniprot No.

Target Background

Function
Recombinant Pongo abelii Magnesium transporter protein 1 (MAGT1) serves as an accessory component of the N-oligosaccharyl transferase (OST) complex. This complex catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This process is crucial for N-glycosylation. MAGT1 plays a role in the N-glycosylation of STT3B-dependent substrates. Specifically, it is essential for the glycosylation of a subset of acceptor sites located near cysteine residues, potentially acting redundantly with TUSC3 in this function. In its oxidized form, MAGT1 is believed to form transient mixed disulfides with a glycoprotein substrate, facilitating access for STT3B to the unmodified acceptor site. MAGT1 also possesses oxidoreductase-independent functions within the STT3B-containing OST complex, possibly involving substrate recognition. Furthermore, MAGT1 might be involved in magnesium transport in epithelial cells.
Database Links
Protein Families
OST3/OST6 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the biological function of MAGT1 in cellular systems?

MAGT1 serves multiple critical functions in cellular biology. It primarily mediates magnesium homeostasis in eukaryotes and is highly conserved across evolutionary branches. Recent research has revealed that MAGT1 functions as the human homolog of yeast OST3/OST6 proteins, forming an integral component of the N-linked glycosylation complex . Additionally, MAGT1 demonstrates thiol-disulfide oxidoreductase activity, supporting the formation of native disulfide bonds in the endoplasmic reticulum .

In human cells, MAGT1 localizes predominantly to the endoplasmic reticulum and Golgi apparatus, where it associates with the STT3B catalytic subunit of the oligosaccharyltransferase (OST) complex . This localization is consistent with its role in glycosylation processes, particularly affecting both immune and non-immune glycoproteins.

How should recombinant MAGT1 be stored and handled for optimal stability?

For optimal stability of recombinant Pongo abelii MAGT1, follow these research-validated protocols:

Storage ConditionRecommendationNotes
Long-term storage-20°C/-80°CAliquoting is necessary for multiple use
Working aliquots4°CStable for up to one week
ReconstitutionDeionized sterile waterConcentration of 0.1-1.0 mg/mL
Glycerol addition5-50% final concentration50% is the standard recommendation
Freeze-thaw cyclesAvoidRepeated freezing and thawing is not recommended

Prior to opening, briefly centrifuge the vial to bring contents to the bottom. After reconstitution in deionized sterile water, add glycerol to a final concentration of 5-50% and prepare aliquots for long-term storage at -20°C/-80°C to prevent protein degradation .

How does MAGT1 deficiency affect glycosylation pathways and immune function?

MAGT1 deficiency has profound effects on glycosylation pathways with consequent immunological implications. Loss-of-function mutations in the MAGT1 gene cause X-linked magnesium deficiency with Epstein-Barr virus (EBV) infection and neoplasia (XMEN) . This disorder manifests with a broad range of clinical and immunological consequences.

MS-based glycoproteomics and CRISPR/Cas9-KO cell line studies have demonstrated that humans lacking functional MAGT1 exhibit a selective deficiency in both immune and non-immune glycoproteins . Critical glycosylation defects have been identified in important immune-response proteins, including CD28, which significantly impacts immune cell function .

Research has shown that MAGT1's role in glycosylation is partially interchangeable with that of its paralog protein tumor-suppressor candidate 3 (TUSC3), although each protein demonstrates a different tissue distribution in humans . Importantly, MAGT1-dependent glycosylation is sensitive to Mg²⁺ levels, and reduced Mg²⁺ impairs immune cell function through the loss of specific glycoproteins .

What is the relationship between MAGT1 and platelet function in thrombosis?

MAGT1 deficiency significantly impacts platelet function with important implications for arterial thrombosis and hemostasis. Studies using MAGT1-deficient mice (Magt1^-/y^) have revealed accelerated occlusive arterial thrombus formation in vivo, shortened bleeding times, and profound brain damage upon focal cerebral ischemia .

The platelet dysfunction in MAGT1 deficiency results from increased calcium influx and enhanced second wave mediator release, which reinforces platelet reactivity and aggregation responses . Mechanistically, glycoprotein VI (GPVI) activation of Magt1^-/y^ platelets results in hyperphosphorylation of Syk (spleen tyrosine kinase), LAT (linker for activation of T cells), and PLCγ2 (phospholipase C γ2), while the inhibitory loop regulated by PKC (protein kinase C) is impaired .

Importantly, a functional link between MAGT1 and TRPC6 (transient receptor potential cation channel, subfamily C, member 6) has been established. The hyperaggregation response to GPVI agonists observed in MAGT1-deficient platelets can be normalized through either MgCl₂ supplementation or pharmacological blockade of TRPC6 channels . This finding has been confirmed in human platelets isolated from MAGT1-deficient patients with X-linked immunodeficiency with magnesium defect syndrome .

How can recombinant MAGT1 be used in functional rescue experiments?

For functional rescue experiments, recombinant MAGT1 can be employed following these methodological steps:

  • Cell Line Selection: Choose appropriate MAGT1-deficient cell lines or primary cells from XMEN patients. Alternatively, generate CRISPR/Cas9 knockout cell lines similar to those described in the literature .

  • Protein Delivery Options:

    • Direct protein transduction using cell-penetrating peptide-tagged recombinant MAGT1

    • Liposomal delivery of purified recombinant protein

    • Viral vector-mediated expression of the recombinant construct

  • Functional Readouts:

    • Measurement of magnesium influx using Mag-Fluo4 dye and time-resolved flow cytometry

    • Assessment of thiol-disulfide oxidoreductase activity using fluorometric glutaredoxin activity assays

    • Evaluation of N-glycosylation of target proteins via glycoproteomics approaches

    • For platelets: analysis of calcium influx, GPVI signaling pathway phosphorylation, and aggregation responses

  • Controls: Include parallel experiments with recombinant TUSC3 to evaluate functional redundancy, as research has shown MAGT1 function is partly interchangeable with TUSC3 .

  • Dose Optimization: Titrate recombinant protein concentrations to determine the minimum effective dose for restoring normal function.

What experimental models are most appropriate for studying MAGT1 function?

Multiple experimental models have been validated for investigating MAGT1 function across different research questions:

Model SystemApplicationsKey Considerations
Magt1^-/y^ miceIn vivo thrombosis, hemostasis, and ischemic stroke studiesMale mice should be used as MAGT1 is X-linked
CRISPR/Cas9 KO cell linesMolecular mechanism studies, protein interaction analysesBoth lymphoid and non-lymphoid cell lines are useful
Patient-derived cellsClinical correlation, human-specific effectsLimited availability; variable phenotypes
Yeast modelsEvolutionary conservation of function, high-throughput screensFocus on OST3/OST6 homology
Recombinant protein systemsBiochemical assays, structural studiesE. coli-expressed protein may lack mammalian modifications

When selecting a model system, consider that Magt1^-/y^ mice are born at normal Mendelian ratios, viable, and fertile, with no obvious signs of disease . Histological analysis of hematopoietic organs including spleen, thymus, lymph nodes, and bone marrow reveals normal tissue morphology in these mice .

For platelet studies, be aware that while platelet count, size, and blood cell distribution are indistinguishable from controls, megakaryocyte number and ploidy in the bone marrow of Magt1^-/y^ mice are slightly increased compared to controls .

How can MAGT1's thiol-disulfide oxidoreductase activity be measured?

MAGT1's thiol-disulfide oxidoreductase activity can be quantified using the following validated approach:

  • Sample Preparation: Isolate platelets, B cells, and T cells from both wild-type and MAGT1-deficient sources using standard protocols.

  • Fluorometric Glutaredoxin Activity Assay:

    • This assay quantifies the conversion of thiol substrate

    • Studies have demonstrated significant reduction of thiol-oxidoreductase activity in MAGT1-deficient platelets, B cells, and T cells

    • Follow manufacturer protocols for commercially available kits or prepare reagents according to published protocols

  • Data Analysis:

    • Compare activity levels between wild-type and MAGT1-deficient samples

    • Normalize to total protein content to account for cell number variations

    • Include positive controls (purified glutaredoxin) and negative controls (heat-inactivated samples)

  • Complementary Approaches:

    • Measure the formation of native disulfide bonds in the ER using conformation-specific antibodies

    • Assess redox state of specific target proteins using redox proteomics approaches

What techniques are available for analyzing MAGT1-dependent magnesium transport?

Several complementary techniques can be employed to analyze MAGT1-dependent magnesium transport:

  • Time-Resolved Flow Cytometry:

    • Load cells with Mg²⁺-specific Mag-Fluo4 dye

    • Measure fluorescence in resting and activated cells

    • This approach has been used to determine basal [Mg²⁺]ᵢ in resting Magt1^-/y^ platelets

  • Inductively Coupled Plasma Mass Spectrometry (ICP-MS):

    • Quantify total Mg²⁺ and Ca²⁺ concentrations in cells

    • This technique has been used to show normal total Mg²⁺ and Ca²⁺ concentrations in Magt1^-/y^ platelets

  • Confocal Microscopy:

    • Use Mag-Fluo4 staining to visualize Mg²⁺ in cellular compartments

    • Has revealed intensive staining in platelet secretory granules of resting cells

  • Electrophysiological Approaches:

    • Patch-clamp techniques to measure MAGT1-dependent currents

    • Can be combined with pharmacological interventions (e.g., TRPC6 channel blockers)

  • Radioisotope Flux Assays:

    • Use ²⁸Mg²⁺ to track magnesium movement across membranes

    • Quantify uptake kinetics in wild-type versus MAGT1-deficient cells

How do you distinguish between direct effects of MAGT1 on magnesium transport versus its role in glycosylation?

Distinguishing between MAGT1's direct effects on magnesium transport versus its role in glycosylation requires careful experimental design and controls:

  • Complementation Experiments:

    • Compare rescue effects of wild-type MAGT1 versus mutant MAGT1 variants with selective defects in either magnesium transport or N-glycosylation functions

    • Use TUSC3 complementation, which shares glycosylation functions but may have different magnesium transport capabilities

  • Temporal Separation:

    • Acute manipulation of extracellular Mg²⁺ levels will affect transport function before significantly altering glycosylation patterns

    • Long-term studies will reveal combined effects of both functions

  • Specific Inhibitors:

    • Use selective inhibitors of N-glycosylation (e.g., tunicamycin) to separate glycosylation-dependent effects

    • Compare with effects of selective magnesium transport inhibitors or magnesium chelators

  • Target Protein Analysis:

    • Examine proteins known to require N-glycosylation but not magnesium for function

    • Study magnesium-dependent enzymes that do not require glycosylation for activity

  • Structural Biology Approaches:

    • Use structure-guided mutagenesis to create variants with selective functional deficits

    • Compare effects on downstream pathways to distinguish mechanism-specific outcomes

What are the implications of MAGT1 deficiency for clinical research?

MAGT1 deficiency has significant clinical research implications across multiple disease domains:

  • Immunodeficiency and Infection:

    • Loss-of-function mutations in MAGT1 cause X-linked magnesium deficiency with Epstein-Barr virus infection and neoplasia (XMEN)

    • MAGT1 deficiency leads to defective expression of the antiviral natural-killer group 2 member D (NKG2D) protein and abnormal Mg²⁺ transport

    • This results in increased susceptibility to viral infections, particularly EBV

  • Thrombosis and Hemostasis:

    • MAGT1-deficient mice display accelerated occlusive arterial thrombus formation and shortened bleeding time

    • Curative hematopoietic stem cell transplantation of XMEN patients can cause fatal bleeding and thrombotic complications

    • MAGT1 deficiency could be a potential risk factor for arterial thrombosis and stroke

  • Stroke Research:

    • MAGT1-deficient mice show profound brain damage upon focal cerebral ischemia

    • This suggests MAGT1 may be a therapeutic target for stroke prevention or treatment

  • Glycosylation Disorders:

    • MAGT1 deficiency represents a congenital disorder of glycosylation affecting multiple glycoproteins

    • This has broader implications for other glycosylation disorders

  • Therapeutic Approaches:

    • Mg²⁺ supplementation normalized aggregation responses of MAGT1-deficient platelets

    • TRPC6 channel blockade also normalized platelet function, suggesting potential therapeutic targets

    • Haploinsufficiency of TRPC6 in Magt1^-/y^ mice normalized GPVI signaling, platelet aggregation, and thrombus formation in vivo

How can contradictory findings in MAGT1 research be reconciled?

When addressing contradictory findings in MAGT1 research, consider these methodological approaches:

  • Tissue-Specific Effects:

    • MAGT1 and its paralog TUSC3 have different tissue distributions in humans

    • Results from different cell types or tissues may legitimately differ due to varying molecular contexts

  • Experimental Conditions:

    • Magnesium concentration in experimental media can significantly influence outcomes

    • MAGT1-dependent glycosylation is sensitive to Mg²⁺ levels

    • Standardize Mg²⁺ concentrations across experiments to ensure comparability

  • Genetic Background Considerations:

    • When using animal models, genetic background can influence phenotypes

    • Magt1^-/y^ mice should be maintained on defined genetic backgrounds (e.g., C57BL/6J)

  • Multi-Omic Approaches:

    • Integrate data from genomics, proteomics, glycomics, and functional assays

    • MS-based glycoproteomics combined with CRISPR/Cas9-KO cell lines and functional assays provides more comprehensive insights

  • Temporal Dynamics:

    • Acute versus chronic MAGT1 deficiency may produce different outcomes

    • Consider developmental timing in animal models and differentiation state in cell cultures

What are the most promising research areas for MAGT1 investigation?

Several research directions hold particular promise for advancing understanding of MAGT1 biology:

  • Structural Biology:

    • Determine high-resolution structures of MAGT1 in different functional states

    • Map interaction interfaces with STT3B and other OST complex components

    • Guide structure-based drug design for modulating MAGT1 function

  • MAGT1-TRPC6 Functional Linkage:

    • Elucidate the molecular mechanisms connecting MAGT1 and TRPC6

    • Develop selective modulators of this interaction for potential therapeutic applications in thrombosis

  • Expanded Disease Associations:

    • Investigate MAGT1's role in additional pathologies beyond immunodeficiency and thrombosis

    • Current evidence suggests MAGT1 overexpression may be associated with aggressiveness in certain contexts

  • Precision Medicine Approaches:

    • Develop patient stratification strategies based on MAGT1 expression or mutation status

    • Design personalized therapeutic interventions for MAGT1-associated disorders

  • Evolutionary Conservation Studies:

    • Compare MAGT1 function across species to identify conserved versus divergent mechanisms

    • The availability of recombinant Pongo abelii MAGT1 provides opportunities for comparative studies with human MAGT1

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.