Recombinant Pongo abelii Membrane-spanning 4-domains subfamily A member 10 (MS4A10)

Shipped with Ice Packs
In Stock

Description

Structure and Biochemical Characteristics

MS4A10 is a 264-amino-acid protein (Uniprot: Q5REZ6) with a molecular weight of approximately 28–30 kDa. Its structure includes:

  • Four transmembrane domains, consistent with the MS4A family’s tetraspanin-like architecture.

  • C-terminal cytoplasmic tail critical for interactions with intracellular signaling molecules.

  • N-linked glycosylation sites for proper protein folding and stability.

The recombinant protein is often expressed as a partial or full-length construct, depending on the host system. For example, full-length versions (1–264 amino acids) are produced in E. coli or mammalian cells, while partial constructs may exclude non-essential regions .

Production Methods and Purity

Recombinant MS4A10 is synthesized using diverse expression systems:

Host SystemPurityKey Applications
E. coli≥85% (SDS-PAGE)Structural studies, binding assays
Mammalian Cells (HEK293)His/Avi/Fc tagsELISA, functional assays
Cell-Free Expression≥85%High-throughput screening
Yeast/Baculovirus≥85%Glycoprotein production

Purity is typically confirmed via SDS-PAGE, and proteins are stored in Tris-based buffers with 50% glycerol at -20°C .

Immune Cell Signaling

MS4A proteins modulate calcium influx and receptor clustering. For example:

  • MS4A1 (CD20) regulates B-cell activation and differentiation .

  • MS4A2 (FcεRI) amplifies mast cell signaling via FcεRIγ subunit interaction .
    Recombinant MS4A10 may serve as a tool to study analogous mechanisms in orangutans.

Alzheimer’s Disease and Neuroinflammation

MS4A4A, a related family member, influences microglial chemokine responses and TREM2 signaling in Alzheimer’s disease (AD) . Recombinant MS4A10 could be used to explore conserved pathways in primates.

Comparative Genomics

MS4A10 is part of the Pongo abelii genome (assembly Susie_PABv2), with orthologs in humans and mice. Comparative studies highlight evolutionary divergence in immune-related genes .

Research Challenges and Gaps

  • Limited Functional Studies: Most data derive from related MS4A proteins (e.g., MS4A1, MS4A4A). Direct evidence for MS4A10’s role in Pongo abelii remains sparse.

  • Species-Specific Variants: Short tandem repeats (STRs) near MS4A genes may influence population-specific traits, as observed in orangutan subspecies .

  • Expression Efficiency: Cell-free or bacterial systems may fail to replicate native glycosylation patterns critical for function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MS4A10; Membrane-spanning 4-domains subfamily A member 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
MS4A10
Target Protein Sequence
MKAEATVIPSRCARGQTTAAPGVQPWQTSVPQNTTQPKLLAPRQHEKSQKRSSLLKELGA FHITIALLHLVFGGYLASTVKSLHLVVLKSWYPFWGAASFLISGILAITMKTFSKTYLKM LCLMTNLVSLFCVLSGLFVISKDLFLESPFESPIWRMYPNSTVHIQRLELALLCFTVLEL FLPVPTAVTAWRDRPSAKNDDACLLPNTPSHLKGLPVEPPPSYQSVIQGDAQHKQHQRLR EVKQVTPDTWIVTDGAGIWTQTAN
Uniprot No.

Target Background

Function
May be involved in signal transduction as a component of a multimeric receptor complex.
Database Links
Protein Families
MS4A family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.