Recombinant Pongo abelii Mitochondrial carrier homolog 2 (MTCH2)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Mitochondrial Biology

MTCH2 has evolved from a transporter to a multifunctional regulator:

Key Functions:

RoleMechanismImpact
Protein InsertaseInserts α-helical tail-anchored (TA) proteins into the OMM Essential for mitochondrial biogenesis, apoptosis, and metabolic signaling
Apoptosis RegulationBinds tBID to activate BAX/BAK-dependent mitochondrial outer membrane permeabilization Determines cell fate under stress conditions
Metabolic RegulationModulates lipid synthesis, ATP production, and mitochondrial fusion Linked to obesity, cancer, and neurodegenerative diseases

Mitochondrial Protein Insertion

  • In Vitro Assays: MTCH2 reconstituted in proteoliposomes mediates TA protein insertion independently of other translocases .

  • Key Substrates: BAK1, BCL2L1 (BCL-XL), and FUNDC1 rely on MTCH2 for OMM integration .

Disease Associations

  • Cancer: Overexpression enhances NSCLC cell proliferation, migration, and ATP production (Fig. 8A–M) .

  • Obesity: MTCH2 knockout reduces lipid storage and protects against diet-induced obesity in mice .

  • Neurodegeneration: Linked to dysregulated mitochondrial dynamics in Alzheimer’s and Parkinson’s diseases .

Evolutionary and Mechanistic Insights

  • Origin: MTCH2 homologs exist in unicellular Choanoflagellata, suggesting ancient origins in mitochondrial regulation .

  • Structural Adaptation: Hydrophilic residues in its transmembrane groove enable membrane protein insertion—a convergent evolutionary trait shared with ER membrane complex (EMC) .

Clinical and Therapeutic Relevance

  • Biomarker Potential: Overexpression correlates with poor prognosis in NSCLC .

  • Drug Target: MTCH2 inactivation sensitizes leukemia cells to apoptosis, suggesting utility in cancer therapy .

Challenges and Future Directions

  • Unresolved Questions: How MTCH2 balances lipid transfer and protein insertion roles remains unclear .

  • Therapeutic Development: Small-molecule modulators of MTCH2 could treat metabolic or oncologic disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MTCH2; Mitochondrial carrier homolog 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-303
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
MTCH2
Target Protein Sequence
ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHI ASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVI KETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAG LVPRLLGDILSLWLCNSLAYLVNTYALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLVS NLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLKM LI
Uniprot No.

Target Background

Function
Induces mitochondrial depolarization. The specific transported substrate remains unidentified.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What experimental systems are most suitable for studying recombinant Pongo abelii MTCH2?

Several experimental systems have proven effective for studying MTCH2, which can be adapted for Pongo abelii MTCH2 research:

  • Cell culture models:

    • Human cell lines (HEK293, K562) for heterologous expression

    • Mouse Embryonic Fibroblasts (MEFs) for knockout/knockdown studies

    • Embryonic Stem Cells (ESCs) for studying developmental roles

  • In vitro reconstitution systems:

    • Purified MTCH2 reconstituted into proteoliposomes for insertase activity studies

    • Cell-free translation systems with rabbit reticulocyte lysate

  • Imaging systems:

    • Fluorescent protein fusions (MTCH2-GFP) for localization and rescue experiments

    • Photoactivatable/photoconvertible proteins for dynamics studies

  • Biochemical approaches:

    • Crosslinking coupled with mass spectrometry to identify interaction partners

    • Immunoprecipitation for studying protein-protein interactions

When working specifically with Pongo abelii MTCH2, researchers should design experiments that account for potential species-specific differences while leveraging the high conservation between human and orangutan proteins.

How do I interpret contradictory findings in MTCH2 research literature?

Contradictory findings in MTCH2 research may stem from several factors:

  • Multiple functions: MTCH2 performs diverse roles (insertase, apoptosis regulator, fusion mediator) that may appear contradictory but actually reflect context-dependent functions .

  • Cell-type specificity: MTCH2's primary function varies across cell types:

    • In cancer cells, its apoptotic role may predominate

    • In stem cells, its role in fusion and differentiation is emphasized

    • In metabolic tissues, its function in lipid homeostasis becomes critical

  • Environmental conditions: Under starvation, MTCH2 promotes mitochondrial hyperfusion for energy efficiency , while under normal conditions, it may primarily function as an insertase.

  • Technical differences: Variations in experimental design, including:

    • Acute versus chronic MTCH2 depletion

    • Complete knockout versus partial knockdown

    • Different model systems (human cells vs. mouse models)

To resolve contradictions, researchers should clearly define experimental conditions, use multiple complementary approaches, and consider the temporal and spatial context of MTCH2 function.

How should I design a system to express and purify functional recombinant Pongo abelii MTCH2?

A comprehensive strategy for expressing and purifying functional recombinant Pongo abelii MTCH2 involves:

  • Expression system selection:

    • Mammalian expression (HEK293) preserves post-translational modifications

    • Insect cell systems (Sf9, Hi5) offer higher yields while maintaining eukaryotic processing

    • Bacterial systems require optimization for membrane protein expression

  • Construct design:

    • N-terminal affinity tag (His6, FLAG) for purification

    • Avoiding C-terminal tags that might interfere with membrane insertion

    • Optional fluorescent protein fusion for tracking (MTCH2-GFP has been shown functional)

    • Codon optimization for the chosen expression system

  • Purification protocol:

    • Gentle membrane solubilization with appropriate detergents (digitonin, DDM, CHAPS)

    • Two-step purification: affinity chromatography followed by size exclusion

    • Detergent exchange during purification if needed for downstream applications

  • Functional validation:

    • Reconstitution into liposomes for insertase activity assays

    • Binding assays with known partners (tBID)

    • Rescue experiments in MTCH2-knockout cells

Sample purification workflow:

  • Express in chosen system with appropriate tags

  • Harvest cells and isolate membrane fraction

  • Solubilize with optimized detergent conditions

  • Perform affinity purification

  • Apply size exclusion chromatography

  • Validate purity by SDS-PAGE and functional activity

Human MTCH2 has been successfully purified and reconstituted into functional liposomes , providing a methodological template for the Pongo abelii ortholog.

What methodologies can quantitatively assess MTCH2's insertase activity?

To quantitatively assess MTCH2's insertase activity:

  • In vitro reconstitution system:

    • Purify MTCH2 and reconstitute into liposomes with defined lipid composition

    • Prepare substrate proteins (tail-anchored proteins like OMP25) using in vitro translation

    • Incubate substrates with MTCH2-proteoliposomes under varying conditions

    • Measure insertion using protease protection assays

  • Quantification approaches:

    • Radiolabeled substrates for sensitive detection

    • Fluorescently labeled substrates for real-time monitoring

    • Dose-response experiments varying MTCH2 concentration

    • Time-course analysis to determine insertion kinetics

  • Essential controls:

    • Empty liposomes (negative control)

    • Isolated mitochondria (positive control)

    • Non-substrate proteins (specificity control)

    • Known insertases like EMC (comparative control)

  • Data analysis:

    • Calculate insertion efficiency (protected fragment/total protein)

    • Determine kinetic parameters (Km, Vmax) for different substrates

    • Compare substrate preferences across different transmembrane domain properties

Previous research demonstrated that purified MTCH2 reconstituted into liposomes inserted the tail-anchored protein OMP25 in a dose-dependent manner correlating with MTCH2 concentration . This assay can be adapted for Pongo abelii MTCH2 to assess evolutionary conservation of function.

How can I investigate MTCH2's role in mitochondrial fusion dynamics?

Investigating MTCH2's role in mitochondrial fusion requires multiple complementary approaches:

  • Live-cell imaging techniques:

    • Photoactivatable mitochondrial markers for fusion rate measurement

    • Time-lapse confocal microscopy to track dynamic changes

    • Quantification of fusion events over time using specialized software

  • Genetic manipulation strategies:

    • CRISPR/Cas9 knockout of MTCH2

    • Rescue experiments with wild-type or mutant MTCH2 variants

    • Combinatorial knockouts with fusion machinery components (MFN1/2)

  • Morphological analysis:

    • 3D reconstruction and quantification of mitochondrial networks

    • Parameters to measure include:

      • Aspect ratio (length/width ratio)

      • Sphericity (3D shape analysis)

      • Branching complexity

      • Network connectivity

  • Biochemical approach:

    • Analysis of lysophosphatidic acid (LPA) levels, which mediates MTCH2-dependent fusion

    • Examination of fusion machinery components (MFN1/2, OPA1) by western blotting

    • Investigation of MTCH2-dependent complex formation

Research has established that MTCH2 knockout results in a less-elongated, more fragmented mitochondrial morphology with quantifiable changes in sphericity and aspect ratio . MTCH2 deletion reduces fusion rates as measured by fluorescence spreading assays using photoactivatable mitochondrial markers . Additionally, MTCH2 promotes mitochondrial elongation in a manner dependent on lysophosphatidic acid generated during de novo lipogenesis .

What approaches can differentiate between MTCH2's direct and indirect effects on cellular metabolism?

Differentiating between MTCH2's direct and indirect metabolic effects requires multi-layered approaches:

  • Temporal analysis strategies:

    • Acute vs. chronic MTCH2 depletion comparisons

    • Time-course metabolomics after MTCH2 manipulation

    • Pulse-chase experiments to track metabolic flux

  • Proximity-based approaches:

    • Proximity labeling (BioID, APEX) to identify direct interaction partners

    • Crosslinking mass spectrometry to map protein-protein interactions

    • In situ analysis of protein complexes during metabolic changes

  • Reconstitution experiments:

    • Reconstitution of purified MTCH2 in minimal systems

    • Step-wise addition of components to identify minimum requirements

    • Rescue experiments with selective complementation of specific functions

  • Metabolic flux analysis:

    • Isotope tracing to follow specific metabolic pathways

    • Seahorse analysis to measure respiratory parameters

    • Lipidomic profiling to identify primary lipid changes

Research shows that MTCH2 deletion results in heightened ATP demand, an oxidized cellular environment, and elevated lipid/amino acid/carbohydrate metabolism . MTCH2 knockout also leads to strategic decreases in membrane lipids with increases in storage lipids . These changes inhibit adipocyte differentiation due to energy imbalance and an oxidized biosynthetic environment , illustrating the complex interplay between direct and indirect effects.

How should I analyze changes in mitochondrial dynamics following MTCH2 manipulation?

Comprehensive analysis of mitochondrial dynamics following MTCH2 manipulation requires:

  • Morphological analysis:

    • Classify mitochondrial morphology into categories (fragmented, intermediate, elongated)

    • Calculate aspect ratios for individual mitochondria

    • Measure 3D sphericity and network connectivity

    • Analyze branching complexity using specialized software

  • Fusion rate quantification:

    • Photoactivation assays measuring fluorescence spreading over time

    • Calculation of fusion events per unit time

    • Analysis of fusion kinetics under various conditions

  • Statistical approaches:

    • Apply appropriate statistical tests based on data distribution

    • Use multiple independent clones to account for clonal variation

    • Employ mixed-effects models for time-course experiments

    • Calculate effect sizes to determine biological significance

  • Correlative analyses:

    • Link morphological changes to functional outcomes (ATP production, ROS levels)

    • Correlate fusion rates with expression levels of key proteins

    • Analyze how lipid composition changes relate to fusion dynamics

  • Visualization and presentation:

    • Representative images showing clear morphological differences

    • Time-lapse sequences demonstrating dynamic changes

    • Quantitative graphs with appropriate error bars and statistical indicators

Studies have shown that MTCH2 knockout in MEFs results in less-elongated/round mitochondria with quantifiable changes in morphology . In embryonic stem cells, MTCH2 deletion similarly leads to a more fragmented mitochondrial network, with quantifiable decreases in fusion rates . These changes can be rescued by re-expression of MTCH2-GFP or by overexpression of MFN2, confirming the specificity of the phenotype .

What statistical methods are appropriate for analyzing gene expression changes in MTCH2-associated pathways?

When analyzing gene expression changes in MTCH2-associated pathways:

  • Experimental design considerations:

    • Use multiple biological replicates (minimum n=3)

    • Include appropriate controls (wild-type, heterozygous, rescue)

    • Consider time-course experiments to capture dynamic changes

  • Preprocessing and normalization:

    • Apply appropriate normalization methods (TPM, RPKM, or DESeq2 normalization)

    • Perform quality control filtering (read depth, mapping quality)

    • Consider batch effect correction when applicable

  • Differential expression analysis:

    • Use specialized software (DESeq2, edgeR, limma)

    • Apply appropriate statistical models (negative binomial for RNA-seq)

    • Control for multiple testing (Benjamini-Hochberg FDR)

    • Set biologically meaningful significance thresholds

  • Pathway and network analysis:

    • Apply Gene Set Enrichment Analysis (GSEA)

    • Use pathway visualization tools (Pathview, Cytoscape)

    • Consider protein-protein interaction networks

    • Apply causal network inference algorithms

  • Validation approaches:

    • Confirm key findings with qRT-PCR

    • Validate protein-level changes by Western blotting

    • Test functional consequences of identified pathway alterations

Research has identified specific pathways affected by MTCH2 manipulation, including:

  • Lipid metabolism and fatty acid synthesis pathways

  • Mitochondrial fusion and fission regulatory networks

  • Apoptotic pathways involving BCL-2 family proteins

  • Energy metabolism and oxidative phosphorylation

These pathways provide a starting point for focused gene expression analysis in MTCH2 studies.

How can I accurately determine the evolutionary history of MTCH2 across primates?

To determine the evolutionary history of MTCH2 across primates:

  • Sequence acquisition and alignment:

    • Obtain MTCH2 sequences from multiple primate species including Pongo abelii (XM_002817792.1)

    • Use multiple sequence alignment tools optimized for membrane proteins

    • Carefully curate alignments to ensure proper gap placement

  • Phylogenetic analysis:

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Apply appropriate evolutionary models (site-heterogeneous models recommended)

    • Assess tree reliability using bootstrap or posterior probability values

    • Compare gene trees with species trees to identify potential discordance

  • Selection analysis:

    • Calculate dN/dS ratios to identify signatures of selection

    • Apply site-specific selection tests to identify functionally important residues

    • Use branch-site models to detect lineage-specific adaptation

    • Examine conserved functional domains versus variable regions

  • Structural implications:

    • Map conservation patterns onto protein structure models

    • Identify conserved functional motifs across primate MTCH2 orthologs

    • Analyze co-evolution patterns with interacting partners

  • Comparative genomics:

    • Examine synteny conservation around the MTCH2 locus

    • Analyze regulatory element conservation

    • Compare with paralogous genes (MTCH1) to understand functional divergence

Available primate MTCH2 sequences for evolutionary analysis include Pongo abelii, Chlorocebus sabaeus, Macaca mulatta, Pan troglodytes, and Callithrix jacchus , providing a solid foundation for detailed evolutionary studies.

What bioinformatic approaches can predict functional domains in Pongo abelii MTCH2?

To predict functional domains in Pongo abelii MTCH2:

  • Sequence-based predictions:

    • Apply transmembrane topology prediction tools (TMHMM, Phobius)

    • Identify conserved motifs using MEME, PROSITE

    • Detect functional domains using Pfam, InterPro

    • Apply specialized membrane protein analysis tools

  • Evolutionary conservation analysis:

    • Calculate position-specific conservation scores (ConSurf)

    • Identify evolutionarily constrained regions across primates

    • Detect co-evolving residue networks that may form functional units

  • Structural predictions:

    • Generate 3D models using AlphaFold or RoseTTAFold

    • Validate models against known carrier protein structures

    • Analyze potential binding pockets and functional interfaces

    • Identify critical residues for membrane insertion and protein function

  • Functional inference:

    • Compare with experimentally characterized domains in human MTCH2

    • Map regions known to interact with tBID (segments 140-161 and 240-290)

    • Identify domains critical for insertase activity

    • Analyze hydrophilic residues embedded in transmembrane regions

  • Integration with experimental data:

    • Incorporate crosslinking data to validate interaction interfaces

    • Use mutagenesis results to refine domain predictions

    • Correlate predicted domains with functional assay outcomes

Research has established that MTCH2 contains critical membrane-embedded hydrophilic residues necessary for its insertase function . The protein has evolved from ancestral solute carrier transporters while adapting structural elements for new functions . Specific segments (positions 140-161 and 240-290) interact with tBID during apoptosis regulation .

How can I design MTCH2 variants to dissect its multiple cellular functions?

Designing MTCH2 variants to dissect its multiple functions requires strategic approaches:

  • Domain-specific mutations:

    • Target membrane-embedded hydrophilic residues crucial for insertase function

    • Modify regions involved in tBID binding (segments 140-161 and 240-290)

    • Alter residues implicated in lipid interaction or scramblase activity

    • Introduce mutations at potential post-translational modification sites

  • Chimeric protein design:

    • Create MTCH2/MTCH1 chimeras to identify paralog-specific functions

    • Develop fusion proteins with domain-specific reporters

    • Generate chimeras between human and Pongo abelii MTCH2 to identify species-specific elements

  • Systematic alanine scanning:

    • Replace conserved residues with alanine across the protein

    • Focus on evolutionarily constrained regions

    • Target potential protein-protein interaction interfaces

  • Functional tagging approaches:

    • Develop split-protein complementation constructs

    • Create FRET-based sensors for conformational changes

    • Design variants with site-specific unnatural amino acids for crosslinking

  • Expression strategies:

    • Use inducible expression systems to control timing and levels

    • Develop tissue-specific or subcellular-specific targeting variants

    • Create dominant-negative variants to disrupt specific functions

When designing variants, researchers should consider the multifunctional nature of MTCH2 and how specific mutations might affect its various roles in insertase activity, apoptosis regulation, mitochondrial fusion, and metabolic control.

What assay systems best evaluate MTCH2's role in cellular bioenergetics?

To evaluate MTCH2's role in cellular bioenergetics:

  • Respirometry approaches:

    • Seahorse XF analysis to measure oxygen consumption rate (OCR) and extracellular acidification rate (ECAR)

    • High-resolution respirometry (Oroboros) for detailed respiratory complex analysis

    • Permeabilized cell respirometry to assess substrate preference

  • ATP production assessment:

    • Luminescence-based ATP quantification

    • FRET-based ATP sensors for real-time, subcellular measurements

    • ATP/ADP ratio analysis as an indicator of energy charge

  • Mitochondrial membrane potential:

    • Potential-sensitive dyes (TMRM, JC-1) for quantitative measurements

    • Time-lapse imaging to monitor dynamic changes

    • Flow cytometry for population analysis

  • Metabolic flux analysis:

    • 13C-labeled substrate tracing to track metabolic pathway utilization

    • Measurement of lactate production vs. pyruvate oxidation

    • Analysis of TCA cycle intermediates

  • Redox state evaluation:

    • Measurement of NAD+/NADH and NADP+/NADPH ratios

    • ROS production quantification

    • Glutathione (GSH/GSSG) ratio assessment

Research has shown that MTCH2 deletion results in heightened ATP demand and an oxidized cellular environment . MTCH2 knockout cells exhibited reduced mitochondrial respiration, decreased complex I activity, lower ATP levels, mitochondrial depolarization, and increased ROS production . Conversely, MTCH2 overexpression enhanced mitochondrial complex I activity and ATP production .

How can I establish a comprehensive protocol for studying MTCH2's impact on apoptotic pathways?

A comprehensive protocol for studying MTCH2's impact on apoptotic pathways:

  • Apoptosis induction and quantification:

    • Compare MTCH2 wild-type, knockout, and overexpression cells

    • Use multiple apoptotic stimuli (imatinib, staurosporine, death ligands)

    • Measure apoptosis by multiple methods:

      • Annexin V/PI staining for flow cytometry

      • Caspase activity assays

      • TUNEL assay for DNA fragmentation

      • Live-cell imaging with fluorescent apoptosis reporters

  • Mitochondrial apoptosis pathway analysis:

    • Assess mitochondrial outer membrane permeabilization (MOMP)

    • Measure cytochrome c release from mitochondria

    • Analyze BAX/BAK activation and oligomerization

    • Investigate tBID recruitment to mitochondria

  • MTCH2-tBID interaction studies:

    • Co-immunoprecipitation under various conditions

    • FRET or BRET analysis for real-time interaction monitoring

    • Crosslinking mass spectrometry to map interaction interfaces

    • Mutagenesis of key interaction residues

  • Biochemical validation:

    • In vitro reconstitution with purified components

    • Liposome permeabilization assays

    • Apoptosome formation and activation analysis

  • Genetic approaches:

    • Epistasis analysis with key apoptotic regulators

    • Rescue experiments with specific MTCH2 variants

    • Comparative analysis across cell types with different apoptotic sensitivities

Research has established MTCH2 as a receptor for tBID that facilitates mitochondrial apoptosis . MTCH2 recruits cBID to mitochondria, unmasks the BH3 domain, and forms a complex with BAX . MTCH2 overexpression increased sensitivity to apoptosis induced by imatinib in human leukemia cells .

What experimental design best addresses MTCH2's role in adipocyte differentiation and lipid storage?

To comprehensively study MTCH2's role in adipocyte differentiation and lipid storage:

  • Cellular models:

    • Preadipocyte cell lines (3T3-L1, OP9)

    • Primary stromal vascular fraction (SVF) cells

    • Embryonic stem cell-derived adipocytes

    • MTCH2 knockout, knockdown, and overexpression models

  • Differentiation assays:

    • Standard adipogenic induction protocols

    • Time-course analysis of differentiation

    • Quantification of lipid accumulation (Oil Red O, BODIPY staining)

    • Expression analysis of adipogenic markers (PPAR-γ, C/EBPα, FABP4)

  • Molecular mechanism investigation:

    • Analysis of de novo lipogenesis pathway

    • Measurement of lysophosphatidic acid (LPA) levels

    • Assessment of redox state during differentiation

    • Mitochondrial morphology and function during adipogenesis

  • Metabolic analysis:

    • Lipidomic profiling at different differentiation stages

    • Isotope tracing to track lipid synthesis and turnover

    • Seahorse analysis to monitor metabolic shifts during differentiation

    • Evaluation of insulin sensitivity and glucose uptake

  • Molecular pathway analysis:

    • Investigation of MTCH2 impact on key signaling pathways (insulin, mTOR)

    • Epigenetic regulation during differentiation

    • Protein-protein interaction networks during adipogenesis

    • Transcriptomic profiling at different differentiation stages

Research has shown that MTCH2 deletion inhibits adipocyte differentiation due to energy imbalance and an oxidized biosynthetic environment . High MTCH2 expression in human white adipose tissue has been correlated with obesity . MTCH2 affects lipid homeostasis by influencing membrane lipid composition and storage lipid accumulation .

What methodological approaches can investigate MTCH2's role in neurodegenerative diseases?

To investigate MTCH2's role in neurodegenerative diseases:

  • Cellular models:

    • Primary neuronal cultures with MTCH2 manipulation

    • iPSC-derived neurons from patients with neurodegenerative diseases

    • Microglial and astrocyte cultures to assess non-neuronal contributions

    • 3D organoid models for complex cellular interactions

  • Mitochondrial function analysis:

    • Assessment of mitochondrial transport in neurons

    • Measurement of mitochondrial quality control (mitophagy)

    • Analysis of bioenergetic capacity at synapses

    • Evaluation of calcium buffering capacity

  • Protein aggregation studies:

    • Investigation of MTCH2's impact on protein aggregation (Aβ, tau, α-synuclein)

    • Analysis of mitochondria-associated membranes (MAMs) in disease models

    • Assessment of unfolded protein response activation

  • In vivo approaches:

    • Neuron-specific MTCH2 knockout or overexpression models

    • Crossing with neurodegenerative disease mouse models

    • Behavioral and cognitive testing

    • In vivo imaging of neuronal activity and mitochondrial function

  • Translational approaches:

    • Analysis of MTCH2 expression in patient samples

    • Investigation of MTCH2 polymorphisms in patient cohorts

    • Development of MTCH2-targeting compounds for therapeutic testing

MTCH2 genetic variants have been associated with neurodegenerative diseases, including Alzheimer's disease . MTCH2's role in mitochondrial dynamics, apoptosis regulation, and metabolism provides potential mechanisms through which it might influence neurodegeneration. Its function as an insertase for mitochondrial outer membrane proteins may affect mitochondrial quality control processes critical for neuronal health .

How can MTCH2's insertase function be targeted for potential therapeutic applications?

Targeting MTCH2's insertase function for therapeutic applications:

  • Target validation approaches:

    • Disease-specific assessment of MTCH2 insertase activity

    • Identification of critical insertase substrates in disease contexts

    • Evaluation of insertase function in patient-derived samples

    • Development of disease-relevant cellular phenotypes dependent on insertase activity

  • Small molecule screening strategies:

    • Development of high-throughput insertase activity assays

    • Design of fluorescence-based screening systems

    • Fragment-based drug discovery approaches

    • Computational screening targeting insertase active sites

  • Structure-based drug design:

    • Utilize structural models of MTCH2's insertase domain

    • Target hydrophilic residues essential for insertase function

    • Design molecules that modulate rather than completely inhibit function

    • Develop allosteric modulators to fine-tune activity

  • Alternative therapeutic approaches:

    • RNA-based therapeutics to modulate MTCH2 expression

    • Protein-protein interaction disruptors for specific MTCH2 complexes

    • Cell-penetrating peptides targeting key interaction domains

    • Gene therapy approaches for hereditary disease contexts

  • Disease-specific considerations:

    • Cancer: Enhance MTCH2's pro-apoptotic functions while minimizing metabolic effects

    • Metabolic disease: Target MTCH2's role in lipid metabolism without affecting mitochondrial dynamics

    • Neurodegeneration: Focus on preserving mitochondrial quality control functions

Research has established MTCH2 as a critical gatekeeper for the mitochondrial outer membrane, controlling mislocalization of tail-anchored proteins and modulating apoptosis sensitivity . Its overexpression in non-small cell lung cancer correlates with poor prognosis, suggesting it as a potential cancer therapeutic target . MTCH2's association with metabolic diseases also positions it as a target for obesity and diabetes interventions .

What experimental designs can elucidate MTCH2's differential roles across tissue types?

To elucidate MTCH2's differential roles across tissue types:

  • Tissue-specific expression and function analysis:

    • Comprehensive profiling of MTCH2 expression across tissues

    • Evaluation of post-translational modifications in different tissues

    • Analysis of tissue-specific binding partners

    • Investigation of tissue-specific subcellular localization

  • Conditional knockout approaches:

    • Generate tissue-specific MTCH2 knockout models using Cre-loxP systems

    • Compare phenotypes across different tissue knockouts

    • Analyze compensatory mechanisms in different tissues

    • Evaluate tissue-specific metabolic alterations

  • Cell type-specific analyses:

    • Single-cell RNA-seq to identify cell populations dependent on MTCH2

    • Spatial transcriptomics to map MTCH2 expression in tissue architecture

    • Cell type-specific isolation and functional characterization

    • Co-expression network analysis to identify tissue-specific functions

  • Functional genomics approaches:

    • CRISPR screens in different cell types to identify context-dependent synthetic lethality

    • Genetic interaction mapping in tissue-specific backgrounds

    • Enhancer/promoter analysis to understand tissue-specific regulation

  • Integrative multi-omics:

    • Combined analysis of transcriptomics, proteomics, and metabolomics data

    • Network-based integration of multi-tissue datasets

    • Systems biology approaches to model tissue-specific functions

Research has shown tissue-specific roles for MTCH2, including its importance in metabolic tissues (adipose, muscle), neural tissues, and cancer cells. Single-cell sequencing has revealed higher MTCH2 expression in cancer cells within non-small cell lung cancer tumor masses . In adipose tissue, MTCH2 regulates differentiation and lipid storage , while in cancer cells, it affects proliferation, migration, invasion, and apoptosis . These diverse functions highlight the importance of tissue-specific analysis in MTCH2 research.

What controls are essential when performing MTCH2 knockdown/knockout experiments?

Essential controls for MTCH2 knockdown/knockout experiments:

  • Genetic controls:

    • Multiple independently derived knockout/knockdown clones (minimum 3)

    • Heterozygous knockout controls to assess gene dosage effects

    • Rescue controls with wild-type MTCH2 expression

    • Non-targeting guide RNA or scrambled shRNA controls

    • Isogenic cell line controls

  • Functional validation controls:

    • Verification of MTCH2 reduction at both mRNA and protein levels

    • Assessment of off-target effects using prediction algorithms

    • Examination of closely related genes (especially MTCH1) for compensatory changes

    • Analysis of mitochondrial mass/number to normalize mitochondrial parameters

  • Phenotypic controls:

    • Positive controls with known phenotypes (e.g., MFN1/2 knockout for fusion)

    • Time-course analysis to distinguish primary from secondary effects

    • Rescue experiments with MTCH2 mutants lacking specific functions

    • Pharmacological controls mimicking specific MTCH2 functions

  • Experimental design controls:

    • Appropriate biological replicates (minimum n=3)

    • Technical replicates to assess experimental variation

    • Blinded analysis of phenotypic outcomes

    • Inclusion of multiple cell types or tissues when possible

  • Reporting controls:

    • Clear documentation of knockout/knockdown efficiency

    • Transparent reporting of failed rescue attempts

    • Disclosure of clone-specific variations

    • Detailed methods enabling reproducibility

Research studies have used multiple independent MTCH2-/- clones to control for clonal variation , performed rescue experiments with MTCH2-GFP to confirm phenotype specificity , and employed positive controls like MFN2 overexpression to validate fusion defects . These approaches provide a robust framework for MTCH2 functional studies.

What are the optimal conditions for immunoprecipitating MTCH2 and its interaction partners?

Optimal conditions for immunoprecipitating MTCH2 and its interaction partners:

  • Sample preparation:

    • Use fresh samples when possible for maximum protein integrity

    • Perform all steps at 4°C to preserve complexes

    • Include protease and phosphatase inhibitors in all buffers

    • Consider crosslinking (formaldehyde, DSP) to stabilize transient interactions

  • Lysis and solubilization:

    • Optimize detergent selection for membrane protein extraction:

      • Digitonin (0.5-1%): Gentle extraction preserving complexes

      • CHAPS (0.5-1%): Effective for mitochondrial membrane proteins

      • DDM (0.5-1%): Stronger solubilization while maintaining structure

    • Avoid harsh detergents (SDS, Triton X-100) that may disrupt interactions

    • Include salt concentrations that maintain specific interactions (typically 100-150mM NaCl)

  • Immunoprecipitation strategy:

    • Antibody selection:

      • Validate antibody specificity with knockout controls

      • Consider epitope location relative to interaction domains

      • Use monoclonal antibodies for higher specificity

    • Alternative approaches:

      • Tagged MTCH2 precipitation (FLAG, HA, His) if antibodies are limiting

      • GFP-Trap for MTCH2-GFP fusion proteins

      • Substrate-based pulldowns for insertase activity studies

  • Washing conditions:

    • Use graduated washing stringency to identify stable versus transient partners

    • Maintain the same detergent concentration as lysis buffer

    • Consider adding competitive ligands to identify specific interactions

  • Elution and analysis:

    • Gentle elution for maintaining complexes (peptide competition)

    • Denaturing elution for comprehensive partner identification

    • Analysis by mass spectrometry for unbiased partner identification

    • Western blotting for verification of specific known partners

Studies have successfully used crosslinking approaches to identify MTCH2 interaction partners during the insertion process . UV-dependent crosslinking with BpA followed by mass spectrometry identified MTCH2 interactions with nascent substrate proteins . Co-immunoprecipitation has been used to study MTCH2's interactions with fusion machinery components .

What are the critical parameters for successfully reconstituting MTCH2 into proteoliposomes?

Critical parameters for successfully reconstituting MTCH2 into functional proteoliposomes:

  • Protein preparation:

    • Ensure high purity (>90%) of isolated MTCH2

    • Maintain protein in stabilizing detergent (digitonin, DDM)

    • Verify protein integrity before reconstitution

    • Consider using freshly purified protein when possible

  • Lipid composition optimization:

    • Test different lipid mixtures mimicking the mitochondrial outer membrane:

      • Phosphatidylcholine (PC): 40-50%

      • Phosphatidylethanolamine (PE): 30-40%

      • Phosphatidylinositol (PI): 5-10%

      • Cardiolipin: 2-5%

    • Consider including lysophosphatidic acid (LPA) based on its role in MTCH2 function

    • Optimize lipid:protein ratio (typically 50:1 to 200:1 by weight)

  • Reconstitution method selection:

    • Detergent removal techniques:

      • Bio-Beads SM-2 adsorption (gentle, gradual removal)

      • Dialysis (slower, less complete removal)

      • Gel filtration (faster, more complete removal)

    • Ensure slow, controlled detergent removal for proper protein incorporation

    • Monitor proteoliposome size distribution (aim for 100-200nm diameter)

  • Quality control assessments:

    • Verify MTCH2 incorporation by:

      • Density gradient centrifugation

      • Protease protection assays

      • Freeze-fracture electron microscopy

    • Confirm proper orientation (right-side-out vs. inside-out)

    • Assess proteoliposome homogeneity and stability

  • Functional validation:

    • Test insertase activity using model substrates (OMP25)

    • Compare with positive controls (isolated mitochondria)

    • Measure dose-dependent activity correlating with MTCH2 concentration

    • Verify specificity using non-substrate proteins as negative controls

Research has successfully reconstituted purified MTCH2 into proteoliposomes that demonstrated dose-dependent insertase activity for tail-anchored proteins like OMP25 . This activity correlated with MTCH2 concentration and achieved efficiency similar to or greater than that observed with isolated mitochondria or EMC proteoliposomes .

What imaging techniques best visualize MTCH2's subcellular distribution and activity?

Optimal imaging techniques for visualizing MTCH2's subcellular distribution and activity:

  • Basic fluorescence microscopy approaches:

    • Immunofluorescence with validated anti-MTCH2 antibodies

    • Expression of fluorescently tagged MTCH2 (N-terminal tag preferred)

    • Co-localization with mitochondrial markers (TOM20, MitoTracker)

    • Deconvolution microscopy for improved resolution

  • Super-resolution microscopy:

    • Stimulated Emission Depletion (STED) microscopy: 30-70nm resolution for detailed mitochondrial structures

    • Single-Molecule Localization Microscopy (STORM/PALM): <20nm resolution for precise protein localization

    • Structured Illumination Microscopy (SIM): 100nm resolution with less phototoxicity for live-cell imaging

  • Live-cell imaging approaches:

    • MTCH2-GFP fusion proteins for dynamics studies

    • Photoactivatable or photoconvertible protein fusions for tracking specific populations

    • FRET-based sensors to monitor MTCH2 interactions or conformational changes

    • Light-sheet microscopy for extended time-lapse with minimal phototoxicity

  • Correlative and multi-modal imaging:

    • Correlative Light and Electron Microscopy (CLEM) for ultrastructural context

    • Immuno-EM for precise localization at nanometer resolution

    • Expansion microscopy for physical magnification of structures

    • Multiplexed imaging to visualize multiple partners simultaneously

  • Functional imaging:

    • Combined imaging of MTCH2 with functional parameters:

      • Mitochondrial membrane potential (TMRM, JC-1)

      • ROS production (MitoSOX, CellROX)

      • Calcium dynamics (Rhod-2, GCaMP-mito)

      • ATP levels (PercevalHR)

Research has successfully used fluorescent MTCH2-GFP fusions to study localization and for rescue experiments . Mitochondrial morphology has been quantified using parameters such as aspect ratio, sphericity, and 3D structural analysis . Photoactivatable GFP targeted to mitochondria has been used to measure fusion rates in MTCH2-knockout cells , while photo-convertible fluorescent proteins (like mito-dendra2) have enabled quantitative analysis of mitochondrial dynamics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.