Recombinant Pongo abelii Mitochondrial glutamate carrier 1 (SLC25A22)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

Mitochondrial glutamate carrier 1 (SLC25A22) belongs to the solute carrier family 25 (SLC25), a group of transport proteins responsible for driving the import of various metabolites into mitochondria. SLC25A22 is also known by alternative names including GC-1 (Glutamate Carrier 1) and Glutamate/H(+) symporter 1, indicating its primary function in transporting glutamate across mitochondrial membranes . The recombinant form derived from Pongo abelii (Sumatran orangutan) is a full-length protein consisting of 323 amino acids with the UniProt identifier Q5RD81 . This carrier protein plays a crucial role in cellular metabolism by facilitating the entry of glutamate into mitochondria, particularly in astrocytes where it is predominantly expressed .

The SLC25A22 protein is part of a larger family of mitochondrial carriers that maintain energy homeostasis in cells. It differs from other mitochondrial carriers such as the aspartate-glutamate carrier isoform 1 (AGC1, encoded by SLC25A12), which has distinct transport properties and tissue distribution patterns . Understanding these differences is essential for properly characterizing the specific functions of SLC25A22 in cellular metabolism and neurological processes.

Functional Significance in Cellular Metabolism

SLC25A22 serves as the principal gate for glutamate entry into mitochondria, playing a crucial role in mitochondrial metabolism and cellular energy production . This function is particularly important in astrocytes, where the protein is predominantly expressed and contributes significantly to glutamate homeostasis in the brain . The transport of glutamate into mitochondria via SLC25A22 is essential for several metabolic pathways, including the tricarboxylic acid (TCA) cycle and oxidative phosphorylation, which are fundamental processes for cellular energy production.

Role in Glutamate Metabolism and Energy Production

Research findings demonstrate that SLC25A22 plays a critical role in glutamate catabolism and energy production in astrocytes. Studies using RNA interference to silence SLC25A22 expression have shown that the absence of this carrier results in reduced nicotinamide adenine dinucleotide (Phosphate) (NAD(P)H) formation upon glutamate stimulation . This indicates that SLC25A22 is necessary for the efficient utilization of glutamate as an energy substrate in mitochondria.

Furthermore, research has revealed that while the mitochondrial respiratory chain remains functional after glucose stimulation in cells lacking SLC25A22, it is not activated by glutamate . This leads to lower levels of cellular adenosine triphosphate (ATP) in cells with silenced SLC25A22 compared to control cells, highlighting the importance of this carrier in maintaining energy homeostasis . The inability to properly metabolize glutamate in the absence of SLC25A22 also results in intracellular glutamate accumulation, further emphasizing its role in glutamate homeostasis .

Implications in Neurological Disorders

Mutations in the SLC25A22 gene have been associated with severe neurological conditions, particularly early epileptic encephalopathy (EEE) and migrating partial seizures in infancy (MPSI) . The complete loss of SLC25A22 activity has been linked to these conditions, although the precise pathophysiological mechanisms remain under investigation . Understanding the function of SLC25A22 in normal physiological conditions and how its dysfunction contributes to disease states is crucial for developing potential therapeutic strategies.

Experimental Models and Research Findings

To study the consequences of SLC25A22 deficiency, researchers have developed in vitro models using RNA interference techniques. In one study, short hairpin RNA (shRNA) designed to specifically silence SLC25A22 was validated in rat C6 glioma cells, resulting in a reduction of SLC25A22 mRNA levels and decreased mitochondrial glutamate carrier activity . The glutamate/glutamate exchange rate was significantly reduced in liposomes reconstituted with SLC25A22-silenced cells compared to control cells, demonstrating the specific impact of SLC25A22 on glutamate transport .

Importantly, the research showed that the absence of glutamate transport via SLC25A22 was not compensated by other carriers such as SLC25A22 isoform 2 (GC2) or the aspartate/glutamate carriers (AGC1-2), which are typically poorly expressed in astrocytes . This lack of compensation highlights the unique and essential role of SLC25A22 in maintaining glutamate homeostasis in astrocytes and potentially explains the severe neurological phenotypes observed in patients with SLC25A22 mutations.

Comparative Analysis with Related Carriers

Research has shown that mutations in SLC25A12 result in reduced or abolished AGC1 activity, leading to impaired myelination in the central nervous system . Studies with AGC1-knockout mice revealed a similar phenotype with developmental delay, motor deficits, and premature death at 3 weeks . These findings highlight the importance of mitochondrial carriers in neurological development and function, with different carriers playing specific roles in maintaining cellular energy metabolism and neurotransmitter homeostasis.

Research Applications of Recombinant SLC25A22

Recombinant Pongo abelii SLC25A22 serves as a valuable tool for various research applications, particularly in studies investigating mitochondrial transport mechanisms, glutamate metabolism, and neurological disorders. The availability of purified recombinant protein enables researchers to conduct functional studies, develop therapeutic strategies, and gain deeper insights into the role of this carrier in health and disease.

Experimental Techniques

Several experimental approaches utilize recombinant SLC25A22 to study its function and implications in disease. These include:

  1. Reconstitution in liposomes to measure glutamate transport activity

  2. RNA interference studies to examine the effects of SLC25A22 silencing

  3. Functional assays to assess the impact on cellular energy metabolism

  4. Structural studies to determine protein conformation and binding sites

In one notable experimental approach, researchers measured the rate of [14C]glutamate/glutamate exchange in liposomes reconstituted with mitochondrial extracts to assess SLC25A22 activity . This technique allowed for the specific quantification of glutamate transport mediated by SLC25A22, providing valuable insights into its functional properties and the consequences of its deficiency.

Future Research Directions

The study of SLC25A22 continues to evolve, with several important research directions emerging. Future studies will likely focus on:

  1. Developing more sophisticated in vivo models of SLC25A22 deficiency

  2. Exploring the detailed structural characteristics of the protein that determine its transport specificity

  3. Investigating potential therapeutic approaches for conditions associated with SLC25A22 dysfunction

  4. Examining the interaction between SLC25A22 and other components of cellular metabolism

Additionally, comparative studies between human SLC25A22 and its orthologs in other species, such as the zebrafish SLC25A22 described in the search results, may provide further insights into the evolutionary conservation and functional significance of this carrier protein .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate special requirements. Please specify your desired format in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it accordingly.
Synonyms
SLC25A22; Mitochondrial glutamate carrier 1; GC-1; Glutamate/H(+ symporter 1; Solute carrier family 25 member 22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-323
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
SLC25A22
Target Protein Sequence
MADKQISLPAKLINGGIAGLIGVTCVFPIDLAKTRLQNQQNGQRMYTSMSDCLIKTIRSE GYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV TTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTAIQLTRDLLRS RGIAGLYKGLGATLLRDVPLSVVYFPLFANLNQLGRPASEEKSPFYVSFLAGCVAGSAAA VAVNPCDVVKTRLQSLQRGVNEDTYSGILDCARKILRHEGPSAFLKGAYCRALVIAPLFG IAQVVYFLGIAESLLGLLQDPQA
Uniprot No.

Target Background

Function
This protein is involved in the transport of glutamate across the inner mitochondrial membrane. Glutamate is cotransported with H+.
Database Links

KEGG: pon:100172007

UniGene: Pab.8758

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SLC25A22 and what is its function in cellular metabolism?

SLC25A22, also known as Glutamate Carrier 1 (GC1), is a member of the solute carrier family 25 that functions as a mitochondrial glutamate transporter. It serves as the principal gate for glutamate entry into mitochondria, playing a crucial role in cellular energy metabolism and glutamate homeostasis .

The protein contains six transmembrane domains, characteristic of mitochondrial solute carriers, and is localized to the inner mitochondrial membrane . SLC25A22 primarily catalyzes the transport of glutamate across this membrane, which is essential for several metabolic pathways including:

  • Mitochondrial glutamate oxidation

  • ATP production

  • NAD(P)H formation

  • Maintenance of intracellular glutamate levels

Experimental evidence demonstrates that silencing SLC25A22 in astrocytes results in reduced NAD(P)H formation upon glutamate stimulation and lower cellular ATP levels, highlighting its importance in energy metabolism .

What experimental models are available for studying SLC25A22 function?

Several experimental systems have been developed to study SLC25A22 function:

  • Cell culture models:

    • Rat C6 glioma cells for initial validation of SLC25A22 silencing

    • Primary astrocyte cultures for studying physiological effects

    • COS-7 cells for protein localization studies

    • INS-1E pancreatic β-cells for investigating metabolic functions

    • PDAC cell lines (MIAPaCa2, PANC1, ASPC1, and SW1990) for cancer research

  • Functional assays:

    • Reconstituted liposome systems for measuring glutamate transport activity

    • Mitochondrial membrane potential measurements using Rhodamine 123

    • NAD(P)H autofluorescence for assessing metabolic activity

    • Proteoliposome reconstitution for glutamate/glutamate exchange studies

  • Genetic manipulation approaches:

    • shRNA-mediated knockdown of SLC25A22 expression

    • Site-directed mutagenesis to create mutant constructs

    • Overexpression systems using plasmid vectors

These models provide complementary approaches for investigating different aspects of SLC25A22 function in various cellular contexts .

What are the pathophysiological consequences of SLC25A22 mutations in neurological disorders?

SLC25A22 mutations have been identified in several neurological conditions, particularly early epileptic encephalopathy (EEE) and migrating partial seizures in infancy (MPSI) . The pathophysiological consequences include:

  • Seizure disorders:

    • Refractory neonatal-onset seizures in most patients

    • Migrating partial seizures in infancy

    • In some cases, late-onset absence seizures (developing as late as 7 years of age)

  • Developmental abnormalities:

    • Developmental delay and hypotonia

    • Global hypomyelination in the brain (similar to phenotypes seen with SLC25A12 mutations)

  • Metabolic alterations:

    • Persistent hyperprolinaemia in some patients

    • Abnormal post-prandial plasma amino acid responses

    • Elevated concentrations of several amino acids in the fed state

  • Cellular pathology:

    • Widespread vacuolation containing neutral and phospholipids in patient fibroblasts

    • Impaired activity of the proline/pyrroline-5-carboxylate (P5C) shuttle

Research using site-directed mutagenesis has demonstrated that specific mutations, such as G110R, disrupt mitochondrial glutamate transport function . The G110R mutation affects a highly conserved glycine residue and is predicted to be damaging according to SIFT prediction software . Functional studies in reconstituted liposomes have confirmed reduced glutamate transport activity with this mutation .

How does SLC25A22 contribute to cellular energy metabolism and ATP production?

SLC25A22 plays a critical role in cellular energy metabolism through several interconnected pathways:

  • Glutamate oxidation pathway:

    • Glutamate entry into mitochondria via SLC25A22 is essential for its oxidation

    • In astrocytes with silenced SLC25A22, NAD(P)H formation upon glutamate stimulation is significantly reduced

    • This indicates impaired glutamate-driven oxidative metabolism

  • Mitochondrial respiratory chain function:

    • Experiments measuring mitochondrial membrane potential (Δψm) show that the respiratory chain remains functional in SLC25A22-silenced cells but is not activated by glutamate

    • When stimulated with glutamate, control astrocytes show hyperpolarization of Δψm (reaching 96.7% ± 0.09% of baseline)

    • In GC1-inactivated astrocytes, this hyperpolarization is much weaker (98.7% ± 0.1%)

    • Glucose stimulation still results in hyperpolarization in SLC25A22-silenced cells, indicating the respiratory chain itself is intact

  • ATP production:

    • The impaired glutamate oxidation results in lower cellular ATP levels in SLC25A22-silenced astrocytes

    • This energy deficit may contribute to neuronal dysfunction in patients with SLC25A22 mutations

The data can be summarized in the following table:

ConditionNAD(P)H increase with glutamateΔψm hyperpolarization with glutamateΔψm hyperpolarization with glucoseATP levels
Control astrocytes2.3% ± 0.2%Strong (96.7% ± 0.09% of baseline)Strong (93.3% ± 0.5%)Normal
SLC25A22-silenced astrocytesNo significant increaseWeak (98.7% ± 0.1% of baseline)Normal (94.6% ± 0.4%)Reduced
Control + DL-TBOA (EAAT inhibitor)No significant increaseNoneNormal (92.1% ± 0.5%)-

This evidence collectively indicates that SLC25A22 is crucial for glutamate-driven energy metabolism in astrocytes .

What role does SLC25A22 play in ferroptosis and cancer biology?

Recent research has identified SLC25A22 as a key regulator of ferroptosis, particularly in pancreatic ductal adenocarcinoma (PDAC) :

  • Ferroptosis resistance:

    • SLC25A22 functions as a repressor of ferroptosis in PDAC cells

    • PDAC cell lines with downregulated SLC25A22 (MIAPaCa2, PANC1, and SW1990) are more susceptible to ferroptosis induced by RSL3 or erastin compared to cells with higher SLC25A22 expression (ASPC1)

    • Experimental overexpression of SLC25A22 inhibits RSL3 and erastin-induced cell death in PDAC cells

  • Lipid metabolism regulation:

    • SLC25A22 upregulates the expression of stearoyl-CoA desaturase (SCD), an enzyme that converts saturated fatty acids to monounsaturated fatty acids (MUFAs)

    • Lipidomic analysis revealed that SLC25A22 knockdown significantly reduced levels of 25 MUFAs

    • MUFAs are associated with ferroptosis resistance by reducing accumulation of cytotoxic lipid ROS in cell membranes

  • Metabolic pathway interactions:

    • SLC25A22 appears to modulate the ATP-AMPK-SCD axis, which mediates ferroptosis resistance in PDAC

    • This represents a novel mitochondrial metabolic pathway controlling ferroptosis sensitivity

  • Therapeutic implications:

    • Genetic deletion of SLC25A22 promotes ferroptosis sensitivity both in vitro and in xenograft mouse models

    • This suggests SLC25A22 could be a potential therapeutic target for enhancing ferroptosis-based cancer therapies

These findings establish SLC25A22 as an important modulator of cancer cell metabolism and survival through its effects on ferroptosis pathways .

What are the metabolic consequences of SLC25A22 deficiency?

SLC25A22 deficiency leads to several significant metabolic alterations:

  • Glutamate accumulation:

    • Intracellular glutamate levels increase progressively in SLC25A22-silenced astrocytes following glutamate stimulation

    • The glutamate/glutamine ratio increases significantly without changes in glutamine levels

    • This accumulation occurs with both glutamate stimulation alone and with combined glutamate and glucose stimulation

  • Amino acid metabolism:

    • SLC25A22 mutations in patients are associated with hyperprolinaemia

    • Post-prandial plasma amino acid responses show abnormally high concentrations of several amino acids

    • This suggests that SLC25A22 is important for amino acid metabolism in the liver as well as in the brain

  • Potential trans-deamination defect:

    • In the fed state, when amino acids are the preferred fuel for the liver, trans-deamination requires transportation of glutamate into liver mitochondria by SLC25A22

    • Deficiency may impair glutamate deamination by glutamate dehydrogenase

  • Proline metabolism:

    • SLC25A22 may transport pyrroline-5-carboxylate/glutamate-γ-semialdehyde as well as glutamate

    • Deficiency could impair the proline/pyrroline-5-carboxylate (P5C) shuttle

    • This may explain the lipid accumulation observed in patient fibroblasts

  • Energy metabolism:

    • Reduced ATP production due to impaired glutamate oxidation

    • Functional but not glutamate-responsive mitochondrial respiratory chain

The experimental evidence for glutamate accumulation is summarized in the following data:

ConditionGlutamate levelGlutamate/Glutamine ratioGlutamine levelAspartate levelAlanine level
ControlBaselineNormalNormalNormalNormal
SLC25A22 knockdown + Glutamate (30 min)IncreasedIncreasedUnchangedSlight increase (not significant)Unchanged
SLC25A22 knockdown + Glutamate (1 h)Further increasedFurther increasedUnchangedSlight increase (not significant)Unchanged
SLC25A22 knockdown + Glutamate + GlucoseHighest increaseHighest increaseUnchangedSlight increase (not significant)Unchanged

These metabolic consequences provide insight into the pathophysiological mechanisms underlying neurological disorders associated with SLC25A22 mutations .

What methodological approaches can be used to study SLC25A22 mutations and their functional consequences?

Researchers can employ several sophisticated methodological approaches to investigate SLC25A22 mutations and their functional impacts:

  • Genetic analysis techniques:

    • Whole exome sequencing to identify novel mutations in patient samples

    • SNP 500K analysis to identify regions with evidence for linkage

    • Sanger sequencing for confirmation of mutations and screening of exons/exon-intron junctions

    • Conservation analysis across species to assess the evolutionary importance of affected residues

  • In vitro mutagenesis and expression systems:

    • Site-directed mutagenesis to create specific mutations (e.g., G110R)

    • Expression of wild-type and mutant constructs in various cell lines

    • GFP-tagging for visualization and localization studies

    • Lentiviral or adenoviral delivery of shRNA for gene silencing

  • Functional transport assays:

    • Reconstituted liposome systems for direct measurement of transport activity

    • [14C]glutamate/glutamate exchange assays

    • Comparison of transport rates between wild-type and mutant proteins

    • Time-course studies (e.g., 1-minute vs. 60-minute incubations)

  • Cellular physiology measurements:

    • NAD(P)H autofluorescence monitoring during substrate stimulation

    • Mitochondrial membrane potential assessment using fluorescent dyes like Rhodamine 123

    • ATP level determination

    • Intracellular amino acid level measurement by HPLC

  • Advanced imaging techniques:

    • Immunohistochemistry for protein localization

    • Electron microscopy for ultrastructural analysis

    • Fluorescence microscopy for co-localization with mitochondrial markers

    • Lipid staining methods (Oil Red O, Sudan Black) to assess lipid accumulation

  • Metabolomic and lipidomic analyses:

    • LC-MS-based nontargeted lipidomic analysis

    • Quantification of glutamate/glutamine ratios

    • Assessment of other amino acid levels affected by SLC25A22 deficiency

  • In vivo studies:

    • Generation of knockout or knockin mouse models

    • Xenograft mouse models for cancer-related studies

    • Behavioral and neurological assessments

    • Metabolic profiling in animal models

These methodological approaches provide a comprehensive toolkit for researchers investigating the functional consequences of SLC25A22 mutations in various contexts, from neurological disorders to cancer biology .

What are the current knowledge gaps and future research directions for SLC25A22?

Despite significant advances in our understanding of SLC25A22, several important knowledge gaps remain:

  • Structural and mechanistic understanding:

    • Detailed structural information about SLC25A22 and its transport mechanism

    • The exact binding sites for glutamate and how mutations disrupt transport

    • Potential interactions with other mitochondrial proteins and transporters

  • Physiological roles beyond known functions:

    • The complete spectrum of substrates transported by SLC25A22

    • The role of SLC25A22 in tissues beyond the brain and pancreas

    • Its contribution to systemic amino acid metabolism

  • Disease mechanisms:

    • How SLC25A22 dysfunction leads to epileptic seizures

    • The molecular mechanism linking SLC25A22 to ferroptosis regulation

    • Potential involvement in other neurological or metabolic disorders

Future research directions should focus on:

  • Development of in vivo models:

    • Creation of SLC25A22 knockout or knockin animal models to study whole-organism effects

    • The search results note that research has been "hampered by the absence of an in vivo model"

  • Therapeutic approaches:

    • Exploring potential treatments for SLC25A22-related disorders

    • Development of small molecules to modulate SLC25A22 activity

    • Gene therapy approaches for SLC25A22 deficiency

  • Multi-omics integration:

    • Combining proteomics, metabolomics, and lipidomics to understand the broader impact of SLC25A22 dysfunction

    • Network analyses to identify compensatory mechanisms and secondary effects

  • Translational research:

    • Identification of biomarkers for SLC25A22-related disorders

    • Development of diagnostic tools based on metabolic signatures

    • Personalized medicine approaches for patients with different SLC25A22 mutations

  • Cell-type specific functions:

    • Deeper investigation of SLC25A22's role in different cell types beyond astrocytes

    • Study of tissue-specific isoforms and their functional differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.