Recombinant Pongo abelii Mitochondrial import inner membrane translocase subunit Tim21 (TIMM21)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TIMM21; TIM21; Mitochondrial import inner membrane translocase subunit Tim21; TIM21-like protein, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-172
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TIMM21
Target Protein Sequence
LAKRLLLPHIVLNKACLKTEPSLRCRLQYQKKTVLPRCILGVTQKTIWTQGPSPGKAKED SSKQVSVHRSQRGGTAVPTSQKVKEAGRDFTYLIVVLFGISITGGLFYTIFKELFSSSSP SKIYGRALEKCRSHPEGRSSHRPRSDVIARICSP
Uniprot No.

Target Background

Function
TIMM21 participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. It is also essential for the assembly of mitochondrial respiratory chain complex I and complex IV as a component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex). It likely shuttles between the presequence translocase and respiratory-chain assembly intermediates, facilitating the incorporation of early nuclear-encoded subunits into these complexes.
Database Links
Protein Families
TIM21 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the molecular function of TIMM21 in mitochondrial import?

TIMM21 is a key component of the TIM23 complex, which functions as the major protein import machinery of the mitochondrial inner membrane. It specifically participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane . Functionally, TIMM21 forms part of the sorting and organization translocase (SORT) complex along with Tim50 and promotes the tethering of the translocase to the outer membrane import pore, facilitating the insertion of proteins into the inner membrane . This function is critical for maintaining mitochondrial proteostasis and function.

Research has established that TIMM21's role extends beyond mere protein import, as it dynamically shuttles between the presequence translocase and respiratory chain assembly intermediates, promoting the incorporation of nuclear-encoded subunits into these complexes . This dual functionality positions TIMM21 as a critical coordinator between protein import and respiratory chain assembly.

How does TIMM21 differ structurally and functionally across species?

TIMM21 shows interesting evolutionary patterns across species:

SpeciesNotable FeaturesFunctional CharacteristicsReference
Yeast (S. cerevisiae)Non-essential at normal growth temperatureInteracts with respiratory subunits of complexes III and IV
ArabidopsisMultiple Tim21-like proteins (AtTim21, AtTim21-like 1, AtTim21-like 2)Deletion causes early seedling lethality; Overexpression increases cell numbers, size and ATP production
Mammals (Human)More specialized roleComponent of MITRAC complex; involved in assembly of respiratory chain complexes I and IV
Pongo abelii172 amino acid mature proteinPredicted to function similarly to human TIMM21

In Arabidopsis, researchers have identified two additional Tim21-like proteins encoded by At2g40800 and At3g56430, which contain similar domains to the original AtTim21 (At4g00026) . The Tim21-like proteins in Arabidopsis have been shown to associate with Complex I, Complex III, and the supercomplex Complex I and III in a time-dependent manner, suggesting an evolutionarily conserved role in linking protein import with respiratory chain assembly .

The differences across species can provide valuable insights into the evolution of mitochondrial import mechanisms and the increasing complexity of respiratory chain assembly in higher organisms.

What are the optimal conditions for storing and handling recombinant TIMM21 protein?

Recombinant Pongo abelii TIMM21 protein should be stored using the following protocol to maintain optimal activity:

  • For long-term storage: Maintain at -20°C or preferably -80°C in a storage buffer containing Tris-based buffer with 50% glycerol, specifically optimized for this protein .

  • For routine experiments: Store working aliquots at 4°C for up to one week .

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity and stability .

When designing experiments, it's critical to note that the protein's activity is highly sensitive to buffer conditions. For functional assays, researchers should equilibrate the protein in appropriate buffer systems that mimic the physiological environment of the mitochondrial intermembrane space (pH ~7.4 with physiological ion concentrations).

How can researchers effectively study TIMM21's dynamic interactions with both TIM23 complex and respiratory chain components?

To investigate the dual role of TIMM21 in protein import and respiratory chain assembly, multiple complementary approaches are recommended:

  • Blue Native PAGE (BN-PAGE) analysis: This technique has successfully demonstrated the incorporation of TIMM21 into respiratory complexes. Time-course assays with radiolabeled TIMM21 precursor proteins have shown incorporation into Complex I, Complex III, and the supercomplex Complex I and III in a time-dependent manner .

  • Yeast two-hybrid assays: These have been employed to validate the interactions observed through BN-PAGE and confirm binding partners .

  • Crosslinking techniques combined with mass spectrometry: EDC crosslinking has revealed interactions between TIMM21 and various components of the import machinery, particularly Tim50 and Tim23. Interestingly, TIMM21-Tim50 crosslinks occur at different faces of Tim21 in the absence and presence of precursor proteins, indicating conformational rearrangements during import .

  • Single particle tracking: This approach can be used to study the dynamic association of TIMM21 with larger complexes. Similar techniques applied to TOM complex components have demonstrated that the trimeric TOM complex (rather than the dimeric form) represents the active translocase .

For optimal results, combining structural approaches (such as cryo-EM) with functional assays (import experiments and respiratory chain activity measurements) provides the most comprehensive understanding of TIMM21's dual functionality.

How do mutations or deficiencies in TIMM21 contribute to mitochondrial diseases?

While TIMM21 mutations have not been extensively characterized in human disease, research on related TIM23 complex components provides valuable insights into potential pathogenic mechanisms:

  • Respiratory chain assembly defects: TIMM21 is required for assembly of mitochondrial respiratory chain complexes I and IV as a component of the MITRAC complex . Deficiencies would likely impact oxidative phosphorylation, similar to the combined OXPHOS deficiency observed in TIMM50 patient fibroblasts .

  • Protein import defects: Reduced function of the TIM23 complex impairs protein import via the TIM23 SORT pathway. This appears to be particularly detrimental for certain respiratory chain components, as observed in TIMM50 deficiency where complexes I, II, and IV were specifically affected while complexes III and V remained intact .

  • Neurological impact: Given that TIMM50 mutations are associated with severe neurological manifestations including epilepsy, developmental delay, and optic atrophy , TIMM21 dysfunction might similarly affect neuronal function. Data from TIMM50-deficient neurons showed increased electrical activity and more action potentials, likely due to decreased levels of potassium channels .

Research into TIMM21's potential role in disease should focus on tissue-specific effects, particularly in high-energy demanding tissues like the brain, heart, and skeletal muscle, where mitochondrial dysfunction typically manifests most severely.

How does TIMM21 expression correlate with mitochondrial stress response pathways?

Although direct experimental data on TIMM21 and stress response is limited in the provided search results, mechanistic insights can be derived from studies of related proteins:

  • TIMM21's position at the interface between protein import and respiratory chain assembly suggests it could serve as a regulatory node during mitochondrial stress.

  • Under conditions of mitochondrial stress, regulation of TIMM21 might allow for prioritization of essential protein import over respiratory chain assembly, or vice versa.

  • The finding that overexpression of AtTim21 in Arabidopsis leads to increased cell numbers, cell size, and ATP production, with upregulation of respiratory chain subunit transcripts , suggests that TIMM21 levels could modulate respiratory capacity in response to energy demands.

Future research should investigate TIMM21 expression and phosphorylation status under various stress conditions (oxidative stress, protein folding stress, membrane potential disruption) to determine its role in mitochondrial stress responses.

What are the most effective approaches for analyzing TIMM21's dynamic interactions within the mitochondrial import machinery?

For advanced study of TIMM21's dynamic interactions within the mitochondrial import machinery, the following methodological approaches are recommended:

  • High-resolution interaction proteomics: Targeted mass spectrometry following immunoprecipitation of TIMM21 under various conditions (with/without substrate, with/without ATP, with varying membrane potential) can reveal condition-specific interactions. This approach has successfully identified 101 proteins and 335 interactions in the CI interaction landscape, including previously unrecognized proteins like TIMMDC1 .

  • Proximity labeling techniques: BioID or APEX2 fused to TIMM21 can identify transient or weak interactors in the native cellular environment, which may be missed by conventional immunoprecipitation.

  • Cryo-electron microscopy: Recent advancements have allowed visualization of the TIM23 complex structure . Similar approaches with tagged TIMM21 could reveal its positioning and conformational changes during the import process.

  • Intein-mediated protein splicing: This technique has been successfully applied to create covalent linkages between mitochondrial import components, allowing for analysis of their combined behavior. For example, Tom20 was successfully linked to Tom7 using the Gp41-1 split intein system with approximately 30% efficiency .

  • Fluorescence correlation spectroscopy (FCS) and Förster resonance energy transfer (FRET): These techniques can measure protein-protein interactions in real-time and determine the kinetics of association/dissociation between TIMM21 and its binding partners.

For all these approaches, careful consideration of the experimental conditions is crucial, as the interactions of TIMM21 are likely dynamic and dependent on the energetic state of mitochondria.

How can researchers effectively incorporate site-directed mutagenesis to study TIMM21 structure-function relationships?

Site-directed mutagenesis is a powerful technique for elucidating structure-function relationships in TIMM21. Based on current knowledge, the following approaches are recommended:

  • Targeted mutagenesis of interface residues: The negatively charged residues that line the cavity of Tim17 have been shown to be functionally important through mutagenesis studies in yeast . A similar approach can be applied to TIMM21, targeting residues at the interface with Tim50, Tim23, or respiratory chain components.

  • Conservative vs. non-conservative substitutions: When designing mutagenesis experiments, include both types of substitutions:

    • Conservative substitutions (maintaining charge/polarity) to assess structural requirements

    • Non-conservative substitutions (charge reversal or drastic changes) to disrupt specific interactions

  • Functional complementation assays: In organisms where TIMM21 is not essential (like yeast), complementation experiments with mutated versions can assess functionality. In Arabidopsis, where Tim21 deletion is lethal , complementation with mutant versions can identify essential domains.

  • Photo-crosslinking with unnatural amino acids: Incorporation of photo-activatable unnatural amino acids (like Bpa) at specific positions in TIMM21 can capture transient interactions with binding partners. This approach has been successful in identifying substrate interactions with Tim17 .

  • Rational design based on evolutionarily conserved residues: A multiple sequence alignment of TIMM21 across species can identify highly conserved residues likely to be functionally important.

Mutation TypeTarget RegionExpected OutcomeAnalytical Method
Charge reversalTim50/Tim23 interfaceDisrupted presequence handoverImport efficiency assays
Hydrophobic patchRespiratory chain interactionImpaired complex assemblyBN-PAGE, respiratory activity
Conserved motifsStructural integrityProtein instabilityThermal shift assays, limited proteolysis
PhosphomimeticRegulatory sitesAltered complex dynamicsDynamic interaction studies

How should researchers interpret contradictory data regarding TIMM21's assembly into different protein complexes?

Contradictory data regarding TIMM21's incorporation into different protein complexes can arise from multiple sources. Consider the following interpretive framework:

  • Dynamic association vs. stable incorporation: TIMM21 likely shuttles between the TIM23 complex and respiratory chain assembly intermediates . Therefore, seemingly contradictory data may reflect different snapshots of a dynamic process rather than actual contradictions.

  • Methodology-dependent results: Different techniques can yield apparently contradictory results:

    • Harsh solubilization conditions may disrupt weak interactions

    • Crosslinking can capture transient interactions that co-immunoprecipitation might miss

    • Expression levels in overexpression systems may alter the distribution between complexes

  • Species-specific differences: As demonstrated by the different roles of Tim21 in yeast and plants , contradictory data may stem from genuine biological differences across species.

  • Developmental or physiological state: The distribution of TIMM21 between complexes might vary with cellular energy demands or developmental stage.

When faced with contradictory data, design experiments that can directly test multiple hypotheses simultaneously. For example:

  • Use gentle and harsh solubilization conditions in parallel

  • Compare native expression with overexpression systems

  • Examine the same experimental conditions across multiple species

  • Analyze different tissues or physiological states within the same organism

What are common pitfalls in experimental design when studying TIMM21 and how can they be avoided?

Several experimental challenges are common when studying TIMM21 and other mitochondrial translocase components:

  • Solubilization conditions:

    • Pitfall: Harsh detergents can disrupt native interactions

    • Solution: Use mild detergents like digitonin for complex isolation; compare multiple detergent conditions

  • Precursor/substrate effects:

    • Pitfall: Ignoring the impact of precursor proteins on TIMM21 interactions

    • Solution: Include experiments both with and without precursor proteins, as TIMM21-Tim50 crosslinks occur at different faces of Tim21 in these conditions

  • Buffer composition:

    • Pitfall: Using non-physiological conditions that don't maintain membrane potential

    • Solution: Include energy sources (ATP, creatine phosphate, creatine kinase) in functional assays; use buffer systems that support membrane potential maintenance

  • Recombinant protein production:

    • Pitfall: Expressing full-length TIMM21 without considering its mitochondrial targeting sequence

    • Solution: Express mature TIMM21 (residues 19-172 for Pongo abelii TIMM21) to avoid aggregation problems with the targeting sequence

  • Crosslinking artifact interpretation:

    • Pitfall: Assuming all crosslinks represent physiologically relevant interactions

    • Solution: Validate crosslinks with multiple techniques and control reactions; use quantitative crosslinking approaches

  • Mitochondrial fractionation quality:

    • Pitfall: Contamination from other cellular compartments

    • Solution: Verify mitochondrial purity with compartment-specific markers; use Percoll gradient purification for high-purity preparations

Researchers should design experiments with appropriate controls and complementary techniques to avoid these common pitfalls and strengthen the reliability of their findings.

What are the most promising areas for future investigation of TIMM21 function in mitochondrial biology?

Based on current knowledge, several promising research directions for TIMM21 include:

  • Structural characterization of TIMM21-containing complexes: While recent advances have provided insights into the TIM23 complex structure , the detailed molecular architecture of TIMM21's interactions with both import machinery and respiratory chain components remains to be elucidated. Cryo-EM studies of TIMM21 in different functional states would be particularly valuable.

  • Tissue-specific functions: Investigating whether TIMM21 has tissue-specific roles, particularly in high-energy demanding tissues like brain and muscle. This could provide insights into potential disease associations.

  • Regulatory mechanisms: Exploring how TIMM21's dual role in import and respiratory chain assembly is regulated, particularly under conditions of mitochondrial stress or altered energy demands. Post-translational modifications likely play an important role in this regulation.

  • Therapeutic targeting: Developing approaches to modulate TIMM21 function could provide therapeutic avenues for mitochondrial disorders. The finding that AtTim21 overexpression increases ATP production suggests TIMM21 enhancement might be beneficial in conditions characterized by energy deficiency.

  • Evolution of import systems: Comparative studies across evolutionarily distant species could reveal how the TIMM21 system evolved alongside increasing complexity of the mitochondrial proteome and respiratory chain.

  • Role in mitochondrial disease: Given TIMM21's function at the interface of protein import and respiratory chain assembly, investigating its potential role in unexplained mitochondrial disorders could yield valuable insights.

How might emerging technologies advance our understanding of TIMM21 function and regulation?

Emerging technologies poised to advance TIMM21 research include:

  • Single-molecule techniques: Technologies like single-molecule FRET or optical tweezers could reveal the dynamic conformational changes of TIMM21 during the import process and its transitions between different complexes.

  • Cryo-electron tomography: This approach could visualize TIMM21-containing complexes in their native membrane environment, providing insights into their spatial organization within mitochondria.

  • Genome editing approaches: CRISPR-Cas9 technology allows for precise manipulation of TIMM21 in various model systems, including the introduction of patient-specific mutations or tagging endogenous TIMM21 for live-cell imaging.

  • Proximity proteomics in defined cellular states: Technologies like TurboID or APEX2 combined with quantitative proteomics could map the TIMM21 interactome under various physiological conditions or stress states.

  • Organoid technologies: Studying TIMM21 function in tissue-specific organoids, particularly cerebral organoids, could reveal its role in human development and disease in a physiologically relevant context.

  • Computational modeling and simulation: Molecular dynamics simulations of TIMM21 and its interacting partners could provide mechanistic insights into how it facilitates protein transport and respiratory chain assembly.

  • Synthetic biology approaches: Designing minimal mitochondrial import systems with defined components could reveal the essential features required for TIMM21 function and potentially allow for the development of TIMM21-inspired biotechnological applications.

These emerging technologies, particularly when used in combination, have the potential to address longstanding questions about TIMM21's dynamic interactions and functional roles in mitochondrial biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.