Recombinant Pongo abelii Mitochondrial import inner membrane translocase subunit Tim23 (TIMM23)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TIMM23; TIM23; Mitochondrial import inner membrane translocase subunit Tim23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TIMM23
Target Protein Sequence
MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEF ILPTGANKTRGRFELAFFTIGGCCMTVAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMV TRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARG GLTGLTLTSLYALYNNWEHMKGSLLQQSL
Uniprot No.

Target Background

Function
Essential component of the TIM23 complex, mediating the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Database Links
Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is TIMM23 and what is its primary function in mitochondria?

TIMM23 is an essential component of the TIM23 complex, which mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. It functions as a channel-forming subunit in the translocase of the inner mitochondrial membrane (TIM23) complex . The TIM23 complex facilitates the import of approximately 60% of the mitochondrial proteome, including matrix proteins, many inner membrane proteins, and some intermembrane space proteins .

Recent structural studies have revealed that contrary to previous assumptions, Tim23 plays primarily a structural role rather than forming the main protein translocation path . Instead, Tim17 constitutes the primary translocation path for preprotein transport, with Tim23 serving as a platform for the association of Tim17, Tim44, and other subunits of the complex .

How conserved is TIMM23 across different species, and what can we learn from studying Pongo abelii TIMM23?

TIMM23 is highly conserved across eukaryotic species, reflecting its essential role in mitochondrial protein import. The Pongo abelii (Sumatran orangutan) TIMM23 protein shares significant sequence similarity with human TIMM23, making it a valuable model for comparative studies .

The amino acid sequence of Pongo abelii TIMM23 (UniProt accession: Q5RDD0) features key functional domains similar to those in humans, including transmembrane regions and interaction domains necessary for its role in protein translocation . Studying TIMM23 from non-human primates like Pongo abelii can provide insights into evolutionary conservation of mitochondrial import machinery and help identify functionally critical regions of the protein.

What are the recommended methods for working with recombinant TIMM23 protein, and what storage conditions should be used?

When working with recombinant Pongo abelii TIMM23 protein:

Storage Conditions:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • Avoid repeated freezing and thawing

  • Store working aliquots at 4°C for up to one week

Buffer Considerations:

  • The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for stability

  • For functional assays, maintain the protein in buffers that preserve membrane protein structure, such as those containing mild detergents or lipid nanodiscs

Handling Recommendations:

  • Minimize exposure to room temperature

  • Use low-binding plasticware to prevent protein loss through adsorption

  • Consider including protease inhibitors when working with the protein in solution

  • For reconstitution experiments, gradual dilution or dialysis methods are preferable to reduce protein aggregation

What antibodies are available for TIMM23 detection and what applications have they been validated for?

Several antibodies against TIMM23 have been developed and validated for various applications:

AntibodyHostApplicationsValidated Species ReactivityDilution Recommendations
ab230253Rabbit PolyclonalWB, IHC-PHuman, MouseWB: 1/1000, IHC: 1/100
82540-1-RRRabbit IgGWB, IP, IHC, IF/ICC, ELISAHuman, Mouse, RatWB: 1/2000-1/10000, IP: 0.5-4.0 μg, IHC: 1/50-1/500, IF/ICC: 1/400-1/1600

Western Blot Detection:
Western blot analysis with these antibodies typically shows a band at approximately 22 kDa, which corresponds to the predicted molecular weight of TIMM23 .

Immunohistochemistry Applications:
For IHC applications, antigen retrieval with TE buffer pH 9.0 or alternatively with citrate buffer pH 6.0 is recommended . TIMM23 antibodies have been successfully used to detect the protein in various tissues including heart, testis, and ovarian cancer tissues .

Immunoprecipitation and Immunofluorescence:
Some antibodies have been validated for immunoprecipitation of TIMM23 from cell lysates and for immunofluorescence microscopy to visualize mitochondrial localization patterns .

What experimental systems are most suitable for studying TIMM23 function?

Several experimental systems have proven effective for investigating TIMM23 function:

Yeast Systems:
Saccharomyces cerevisiae remains one of the most well-established model systems for studying TIMM23 due to the extensive genetic tools available and the non-essential nature of some TIM23 complex components . Key approaches include:

  • Temperature-sensitive mutants to study essential components

  • Inducible expression systems for controlled protein levels

  • In vitro import assays using isolated mitochondria

  • Cryo-EM structural studies of purified complexes

Mammalian Cell Culture:
Human cell lines such as HeLa, MCF-7, Jurkat, and HepG2 have been used successfully for TIMM23 research , offering advantages for studying:

  • Disease-relevant contexts

  • Post-translational modifications

  • Protein-protein interactions via co-immunoprecipitation

  • Localization via immunofluorescence microscopy

In vitro Reconstitution Systems:
Functional studies often employ:

  • Liposome reconstitution of purified components

  • Crosslinking approaches to capture transient interactions

  • Blue-native PAGE to study complex formation

  • Stalled translocation intermediates to investigate the import process

How does the recent structural revelation that Tim17, not Tim23, forms the protein translocation path change our understanding of mitochondrial protein import?

The discovery that Tim17, rather than Tim23, forms the protein translocation path represents a paradigm shift in our understanding of mitochondrial protein import mechanisms . This finding challenges the prevailing model that has guided research for decades.

Key Implications for Research:

  • Cavity Structure and Function:

    • Tim17's cavity is large enough to accommodate a polypeptide chain and contains highly conserved acidic amino acids forming a negatively charged patch extending ~8 Å into the membrane from the intermembrane space (IMS)

    • Tim23's cavity is more restricted and occupied by a well-ordered phospholipid, with its vertical axis largely obstructed on the matrix side by a segment of Tim44

    • This suggests research should focus on Tim17's role in substrate recognition and translocation

  • Functional Evidence:

    • Mutations of acidic residues in Tim17's cavity (D17N, D76N, E126Q) severely impair cell viability and protein import

    • Similar mutations in Tim23's cavity have no detectable effect on growth

    • Crosslinking experiments show substrates interact extensively with Tim17 but only weakly with Tim23

  • Mgr2/ROMO1 Role Reconsideration:

    • The non-essential subunit Mgr2 (ROMO1 in humans) seals the lateral opening of the Tim17 cavity, facilitating efficient translocation

    • In the absence of Mgr2, substrate polypeptides can still move across Tim17's cavity but with part of the polypeptide exposed to lipids

    • This explains the ability of TIM23 to detect and integrate transmembrane sorting signals during translocation

  • Methodological Approaches for New Model Testing:

    • Site-specific crosslinking with p-benzoyl-L-phenylalanine (Bpa)

    • Mutational analysis of conserved residues within the cavities

    • In vitro reconstitution with purified components

    • Substrate trapping approaches to capture translocation intermediates

What is known about the regulation of TIMM23 expression and how can researchers experimentally manipulate its levels?

TIMM23 expression is regulated through complex transcriptional and post-transcriptional mechanisms:

Transcriptional Regulation:

  • The promoter regions of human TIMM23 and its paralog TIMM23B contain functional binding sites for:

    • GA-binding protein (GABP) - three functional sites

    • Recombination signal binding protein for immunoglobulin kappa J (RBPJ) - one functional site

  • Silencing of GABPA, the gene encoding the DNA-binding subunit of GABP, results in reduced expression of both TIMM23 and TIMM23B

Experimental Approaches to Manipulate TIMM23 Levels:

  • Transcriptional Modulation:

    • CRISPR-Cas9 targeting of GABP binding sites in the TIMM23 promoter

    • RNAi-mediated knockdown of GABPA to reduce TIMM23 expression

    • Luciferase reporter assays to study promoter activity under different conditions

  • Post-transcriptional Regulation:

    • siRNA or shRNA targeting TIMM23 mRNA

    • Overexpression systems using strong promoters (e.g., CMV)

    • CRISPR-Cas9 gene editing to introduce tags or mutations

  • Protein Stability Modulation:

    • Proteasome inhibitors to evaluate degradation pathways

    • Protein-protein interaction disruption using peptide mimetics

  • Assessing Functional Consequences:

    • Oxygen consumption rate measurements

    • Mitochondrial membrane potential assays

    • Protein import efficiency assays

    • Blue native PAGE to analyze complex assembly

    • Cell viability and stress response analyses

How do mutations or altered expression of TIMM23 contribute to disease pathology, and what experimental models can be used to study these mechanisms?

While direct pathogenic mutations in TIMM23 have not been reported , altered TIMM23 function or expression may contribute to various diseases:

Disease Associations:

  • Cardiomyopathy (both familial hypertrophic cardiomyopathy 16 and 18)

  • Potential role in diseases associated with mitochondrial dysfunction

  • Possible involvement in the mitophagy process through interaction with PINK1, relevant to Parkinson's disease

Experimental Disease Models:

  • Cell Culture Models:

    • Patient-derived fibroblasts or induced pluripotent stem cells (iPSCs)

    • CRISPR-engineered cell lines with TIMM23 mutations or altered expression

    • Stress conditions that mimic disease states (e.g., oxidative stress, metabolic challenges)

    • Co-culture systems to study tissue-specific effects

  • Organoid Models:

    • Cardiac organoids for studying cardiomyopathy phenotypes

    • Brain organoids for neurodegenerative disease modeling

    • Liver organoids for metabolic disease studies

  • Animal Models:

    • Conditional knockout or knockdown mice

    • Transgenic expression of mutant TIMM23

    • Drosophila models for high-throughput screening

  • Analytical Approaches:

    • Proteomics to identify altered mitochondrial protein composition

    • Metabolomics to detect metabolic changes

    • Live-cell imaging to monitor mitochondrial dynamics

    • Electron microscopy to assess mitochondrial ultrastructure

    • Functional assays for respiratory chain activity and ATP production

What is the role of TIMM23 in stress-induced mitophagy, and how can this process be experimentally monitored?

Recent research has revealed that TIMM23 plays a role in the activation of stress-induced mitophagy:

Functional Role:

  • TIMM23 protects PINK1 (a key mitophagy regulator) from OMA1-mediated degradation

  • It facilitates PINK1 accumulation at the outer mitochondrial membrane in response to depolarization

  • This function is critical for initiating the PINK1-Parkin pathway of mitophagy

Experimental Methods to Monitor TIMM23's Role in Mitophagy:

  • Mitochondrial Depolarization Assays:

    • CCCP, FCCP, or antimycin A/oligomycin treatment to induce mitochondrial depolarization

    • JC-1 or TMRM staining to confirm mitochondrial membrane potential loss

    • Time-course analysis of PINK1 stabilization in WT vs. TIMM23-deficient cells

  • PINK1-Parkin Pathway Analysis:

    • Western blotting for PINK1 accumulation

    • Monitoring Parkin recruitment to mitochondria using immunofluorescence or Parkin-GFP fusion proteins

    • Ubiquitination assays to detect increased ubiquitination of outer mitochondrial membrane proteins

  • Mitophagy Flux Measurement:

    • mt-Keima or mito-QC fluorescent reporters

    • Co-localization of mitochondrial markers with autophagosomal/lysosomal markers

    • Electron microscopy to visualize mitochondria within autophagosomes/autolysosomes

    • Biochemical measurement of mitochondrial protein degradation rates

  • Molecular Mechanism Investigation:

    • Co-immunoprecipitation of TIMM23 with PINK1

    • Analysis of OMA1 activity in the presence/absence of TIMM23

    • In vitro reconstitution of PINK1 import and processing

What are the challenges in comparing Tim23 function between yeast and human systems, and how can researchers address these differences?

Studying TIMM23 across species presents several challenges due to evolutionary differences in the mitochondrial import machinery:

Key Differences Between Yeast and Human Systems:

  • Complex Composition:

    • Humans have multiple isoforms of presequence translocases, while yeast has a single TIM23 complex

    • Humans possess isoforms of Tim17 (TIMM17A and TIMM17B) and DnaJC (homolog of yeast Tim14/Pam18)

    • This results in three TIMM23 complexes in humans versus one in yeast

  • Structural Variations:

    • In yeast, Tim50 contains an extra presequence-binding domain (PBD) at its C-terminus (residues 395-476) that is absent in human TIMM50

    • Human TIMM50 cannot complement its yeast homolog, indicating functional differences

  • Regulatory Mechanisms:

    • Human cells lack an identified homolog of yeast Pam17, which plays a supportive role in the PAM complex

    • The yeast Mgr2 role appears to be performed by ROMO1 in humans, but this has only been demonstrated for one protein (YME1L)

Methodological Approaches to Address These Differences:

  • Complementation Studies:

    • Expression of human TIMM23 in yeast with tim23 deletions or temperature-sensitive mutations

    • Creation of chimeric proteins with domains from different species

    • Careful phenotypic analysis of complementation efficiency

  • Comparative Biochemistry:

    • Side-by-side import assays using isolated mitochondria from both species

    • Reconstitution of purified components from each species in liposomes

    • Crosslinking studies to compare substrate interaction patterns

  • Evolutionary Analysis:

    • Sequence alignments to identify conserved versus divergent regions

    • Analysis of co-evolution patterns between interacting components

    • Targeted mutagenesis of species-specific residues

  • Systems Biology Approaches:

    • Proteomics to compare the interactome of TIMM23 in different species

    • Analysis of expression patterns and regulation in different cell types

    • Integration of data across species to identify core conserved functions

What are the most reliable methods for analyzing TIM23 complex formation and dynamics in experimental settings?

Investigating the dynamic assembly and function of the TIM23 complex requires specialized approaches:

Recommended Methodological Approaches:

  • Blue Native PAGE (BN-PAGE):

    • Allows visualization of intact protein complexes

    • Can detect different subcomplexes (TIM23CORE, TIM23SORT, TIM23MOTOR)

    • Combined with second-dimension SDS-PAGE for subunit composition analysis

    • Requires careful optimization of digitonin or other mild detergent concentrations

  • Co-immunoprecipitation (Co-IP):

    • Useful for studying interactions between specific components

    • Can detect dynamic changes in complex composition under different conditions

    • Tag-based approaches (e.g., Spot-tag) have been successfully used

    • Requires careful selection of detergents and buffer conditions to maintain interactions

  • Crosslinking Mass Spectrometry (XL-MS):

    • Identifies interaction interfaces between subunits

    • Captures transient or dynamic interactions

    • Various crosslinkers with different spacer lengths can probe spatial relationships

    • Site-specific incorporation of photo-activatable crosslinkers provides precise interaction data

  • Fluorescence-Based Approaches:

    • FRET (Förster Resonance Energy Transfer) to monitor protein-protein interactions

    • FRAP (Fluorescence Recovery After Photobleaching) to assess complex dynamics

    • Split fluorescent proteins to visualize complex assembly in living cells

    • Single-molecule tracking to follow individual complexes

  • Structural Biology Methods:

    • Cryo-EM has recently provided breakthrough structural insights at 2.9 Å resolution

    • X-ray crystallography of individual domains or subcomplexes

    • NMR spectroscopy for studying dynamic regions or small domains

    • AlphaFold2 predictions have shown remarkable accuracy for TIM23 complex structure

What are the most effective approaches for studying TIMM23's role in protein translocation across the mitochondrial inner membrane?

Several specialized techniques have been developed to study the dynamic process of protein translocation:

Methodological Approaches:

  • In vitro Import Assays:

    • Radiolabeled or fluorescently labeled precursor proteins

    • Isolated mitochondria from various sources (yeast, mammalian cells)

    • Time-course analysis to follow import kinetics

    • Protease protection assays to distinguish between binding, translocation, and processing steps

    • ATP and membrane potential depletion to dissect energy requirements

  • Translocation Intermediate Trapping:

    • Fusion proteins with folded domains (e.g., DHFR) that cannot be imported

    • Model substrates containing an N-terminal matrix targeting signal followed by a long linker and a folded domain (e.g., Grx5-S80-sfGFP)

    • Chemical crosslinking to capture transient interactions

    • Two-step import protocols to synchronize translocation events

  • Site-Specific Crosslinking:

    • Incorporation of p-benzoyl-L-phenylalanine (Bpa) into specific positions of:

      • Substrate proteins to map their path through the complex

      • Tim17 and Tim23 to identify regions interacting with substrates

    • UV-induced crosslinking followed by immunoprecipitation

    • Mass spectrometry to identify crosslinked residues

  • Electrophysiological Methods:

    • Patch-clamp of mitochondrial membranes or reconstituted proteoliposomes

    • Planar lipid bilayers with incorporated TIM23 components

    • Single-channel recordings to measure conductance and gating properties

  • Advanced Imaging Approaches:

    • Super-resolution microscopy to visualize import sites

    • Single-molecule FRET to monitor conformational changes during translocation

    • Correlative light and electron microscopy to combine functional and structural data

What are the critical unanswered questions about TIMM23 function that require further investigation?

Despite significant advances in understanding TIMM23, several key questions remain:

  • Structural Dynamics During Protein Import:

    • How does the Tim17 channel accommodate polypeptides of different sizes and properties?

    • What conformational changes occur in the complex during the import process?

    • How is the lateral release of transmembrane segments into the inner membrane coordinated?

  • Tissue-Specific Functions:

    • Do the multiple human TIMM23 complexes have tissue-specific roles?

    • How is TIMM23 function modulated in tissues with high energy demands (e.g., heart, brain)?

    • Are there tissue-specific interacting partners that regulate TIMM23 activity?

  • Disease Mechanisms:

    • Why have no pathogenic mutations been identified in TIMM23, despite its essential role?

    • How does TIMM23 dysfunction contribute to diseases associated with mitochondrial defects?

    • Could TIMM23 be a therapeutic target for mitochondrial disorders?

  • Regulatory Mechanisms:

    • How is TIMM23 expression coordinated with mitochondrial biogenesis?

    • What post-translational modifications regulate TIMM23 function?

    • How is protein import through the TIM23 complex regulated under different metabolic conditions?

  • Evolution of Import Machinery:

    • How did the specialized functions of Tim17 and Tim23 evolve?

    • Why do humans have multiple isoforms of import components?

    • What can we learn from studying TIMM23 in diverse species like Pongo abelii?

How can researchers leverage new technologies to advance understanding of TIMM23 function and regulation?

Emerging technologies offer exciting possibilities for TIMM23 research:

  • CRISPR-Based Approaches:

    • Base editing or prime editing for precise modification of TIMM23 and interacting partners

    • CRISPRi/CRISPRa for tunable control of expression levels

    • CRISPR screens to identify novel regulators or modifiers of TIMM23 function

  • Proximity Labeling Proteomics:

    • BioID, TurboID, or APEX2 fusions to map the spatial proteome around TIMM23

    • Temporal control of labeling to capture dynamic changes in the TIMM23 interactome

    • Compartment-specific labeling to distinguish matrix, membrane, and IMS interactions

  • Advanced Imaging Technologies:

    • Live-cell super-resolution microscopy to visualize TIMM23 complexes

    • Lattice light-sheet microscopy for extended imaging with minimal phototoxicity

    • Single-molecule tracking to follow import dynamics in real-time

    • Cryo-electron tomography to visualize TIMM23 in its native membrane environment

  • Computational Approaches:

    • Molecular dynamics simulations of the Tim17-Tim23 complex in lipid bilayers

    • Machine learning to predict substrate recognition and import efficiency

    • Systems biology models integrating multiple omics datasets

    • AlphaFold2 predictions of complex structures and substrate interactions

  • Organoid and In Vivo Models:

    • Patient-derived organoids to study disease-specific phenotypes

    • Tissue-specific conditional knockout models in mice

    • In vivo imaging of mitochondrial protein import

    • Therapeutic approaches targeting TIMM23 function or expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.