Recombinant Pongo abelii Mitochondrial import inner membrane translocase subunit TIM50 (TIMM50)

Shipped with Ice Packs
In Stock

Description

Introduction to TIMM50

TIMM50 (Translocase of Inner Mitochondrial Membrane 50) is an essential component of the mitochondrial protein import machinery. Specifically, it functions as part of the TIM23 complex, which represents the main entry gate for proteins destined for the mitochondrial matrix and inner membrane . The protein spans the inner mitochondrial membrane with a single transmembrane segment and features a large hydrophilic domain that extends into the intermembrane space .

Research has demonstrated that TIMM50 is critical for cell viability, as its deletion in yeast models proves lethal . Depletion of TIMM50 leads to virtually complete growth inhibition, placing it among a relatively small group of mitochondrial proteins essential for organism viability . This group encompasses components of import complexes, molecular chaperones, and enzymes involved in Fe/S protein biogenesis pathways.

Biological Functions and Mechanism

TIMM50 plays a crucial role in the protein import process across mitochondrial membranes. Recent research has revealed that TIMM50 contains two distinct domains in the intermembrane space, referred to as the core domain and PBD (presequence binding domain), both of which have essential but different roles in protein translocation .

The core domain contains the main presequence-binding site and serves as the primary recruitment point to the TIM23 complex . Meanwhile, the PBD plays a critical role in the cooperation between the TOM (Translocase of Outer Membrane) and TIM23 complexes and supports the receptor function of TIMM50 . Together, these domains coordinate the translocation of proteins across both mitochondrial membranes.

Functionally, TIMM50 exhibits several biochemical activities, including:

  • RNA binding

  • Interleukin-2 receptor binding

  • Phosphoprotein phosphatase activity

  • Protein binding

  • Protein serine/threonine phosphatase activity

  • Protein tyrosine phosphatase activity

  • Ribonucleoprotein complex binding

TIMM50 is primarily involved in two major cellular pathways:

  1. Metabolism of proteins

  2. Mitochondrial protein import

Research Applications

Recombinant Pongo abelii TIMM50 serves several important research purposes:

Mitochondrial Import Studies

The protein is a valuable tool for investigating the mechanisms of protein import into mitochondria. Studies have shown that mitochondria isolated from cells depleted of TIMM50 display a strong reduction in the import of matrix proteins and partial inhibition of import of proteins sorted by the TIM23 complex using the stop-transfer mechanism .

Structure-Function Analysis

The availability of recombinant TIMM50 enables researchers to conduct structure-function analyses to better understand how this protein facilitates the transfer of preproteins from the TOM complex to the TIM23 complex through the intermembrane space .

Protein Interaction Studies

TIMM50 can be cross-linked to preproteins halted at the level of the TOM complex or spanning both TOM and TIM23 complexes, indicating its role in protein-protein interactions during mitochondrial import . Recombinant TIMM50 allows for detailed investigation of these interactions.

Evolutionary Conservation and Comparative Analysis

TIMM50 is evolutionarily conserved across species, indicating its fundamental importance in cellular function. The Pongo abelii version shares significant homology with human TIMM50, which is encoded by the TIMM50 gene .

The human recombinant version of TIMM50 is typically expressed with a GST-tag, with a protein length of C-267aa, and is stored in PBS buffer containing 100mM GSH and 1% Triton X-100 with 15% glycerol . This comparative information highlights the structural similarities and differences between primate TIMM50 proteins, which can inform evolutionary studies and functional analyses.

Importance in Development and Disease

Research on TIMM50 homologs in model organisms has revealed its critical role in development. Studies in Drosophila have shown that mutations in the TIMM50 ortholog (named tiny tim 50 or ttm50) produce developmental phenotypes, including reduced cell size and number, with growth termination at the larval stage in strong alleles .

TIMM50 is known to maintain mitochondrial membrane potential (MMP) while facilitating inner-membrane protein transport. In Drosophila mutants, mitochondrial morphology and MMP were affected, indicating that mitochondrial dysfunction causes the developmental phenotype . Conversely, overexpression increased MMP and apoptosis, with co-expression of p35 suppressing this apoptosis and resulting in cell overproliferation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but customers may adjust as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
TIMM50; TIM50; Mitochondrial import inner membrane translocase subunit TIM50
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-353
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
TIMM50
Target Protein Sequence
STKAQGPQQQPGSEGPSYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDN DPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLHLEWS LATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATR YMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLK TIALNGVEDVRTVLEHYALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTS RLWPRSKQP
Uniprot No.

Target Background

Function

Recombinant Pongo abelii Mitochondrial import inner membrane translocase subunit TIM50 (TIMM50) is an essential component of the TIM23 complex. This complex facilitates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. While exhibiting some phosphatase activity in vitro, the in vivo relevance of this activity remains unclear.

Database Links

KEGG: pon:100172637

UniGene: Pab.7519

Protein Families
TIM50 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the basic domain organization of TIM50/TIMM50?

TIM50 is a critical component of the mitochondrial inner membrane translocase (TIM23 complex) that spans the inner membrane with a single transmembrane segment and exposes a large hydrophilic domain in the intermembrane space (IMS) . The IMS portion consists of two structurally distinct functional domains: the core domain (approximately amino acids 133-365) and the C-terminal presequence-binding domain (PBD) (approximately amino acids 366-476) . The core domain contains a large groove that serves as a putative binding site for presequences, while the PBD has specialized functions in preprotein recognition .

How does the crystal structure of TIM50's IMS domain inform our understanding of its function?

The crystal structure of TIM50's IMS domain (published in 2011) revealed crucial structural features that explain its role in protein import. The structure belongs to space group P6₁22 with cell dimensions a=84.109Å, c=116.549Å, and was resolved to 1.83Å . This high-resolution structure identified a large groove as the putative binding site for presequences and an exposed β-hairpin important for interactions with other components of the import machinery . These structural elements explain how TIM50 can recognize diverse mitochondrial targeting sequences and coordinate the transfer of preproteins between the TOM and TIM23 complexes.

What are the optimal conditions for reconstituting recombinant TIM50 protein for functional studies?

For optimal reconstitution of lyophilized recombinant TIM50 protein, researchers should first briefly centrifuge the vial to bring contents to the bottom before opening. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, addition of 5-50% glycerol (final concentration) followed by aliquoting and storage at -20°C/-80°C is recommended . To preserve activity, avoid repeated freeze-thaw cycles, and working aliquots should be stored at 4°C for no longer than one week . These conditions maintain the structural integrity and functionality of the recombinant protein for experimental applications.

What genetic models have been developed to study TIM50 function in vivo?

Several genetic models have been developed to study TIM50 function. In yeast, Tim50 shuffling strains allow for the exchange of wild-type Tim50 with mutant variants . Global TIM50 knockout mice have been generated using CRISPR-Cas9 technology, with guide sequences targeting the mouse TIM50 gene designed using online CRISPR design tools . Additionally, cardiac-specific TIM50 overexpression mice have been created to investigate TIM50's role in cardiac hypertrophy . For controlled expression studies in yeast, strains with Tim50 variants under the GAL promoter enable inducible expression or depletion of specific Tim50 domains . These models provide versatile tools for investigating TIM50 function in different biological contexts and at varying levels of complexity.

How can researchers effectively isolate and purify the TIM23 complex containing native TIM50?

To isolate the TIM23 complex containing native TIM50, researchers have successfully employed affinity purification methods as demonstrated in studies with both yeast and Neurospora crassa . One effective approach involves solubilizing mitochondrial membranes with digitonin, a mild detergent that preserves protein-protein interactions within the complex . Coimmunoprecipitation experiments using antibodies against Tim50 or other components of the TIM23 complex can then be performed to isolate the intact complex . For analysis of specific interactions, cross-linking agents can be applied prior to solubilization to capture transient protein-protein interactions, such as those between Tim50 and preproteins . This methodological approach has been instrumental in defining the composition and dynamics of the TIM23 complex across different species.

How can the trans-complementation approach with TIM50 domains advance understanding of protein import mechanisms?

The trans-complementation approach with TIM50 domains represents a powerful tool for dissecting the specific functions of individual domains. Studies have shown that co-expression of the core domain (Tim50(1-365) or Tim50(1-370)) and the presequence-binding domain (Tim50(366-476)) in trans can reconstitute Tim50 function in vivo, despite these domains being expressed as separate proteins . This approach, which produces viable yeast strains (termed "50split" versus "50FL" for full-length Tim50), enables researchers to introduce mutations or modifications in one domain without affecting the other . By analyzing the effects of such domain-specific alterations on protein import efficiency, researchers can map the precise functional contributions of each domain and investigate their coordination during the import process. This method has already revealed that the two domains can functionally cooperate even when not covalently linked, suggesting a modular organization of Tim50 activity .

What are the current hypotheses regarding the differential roles of TIM50's core domain versus presequence-binding domain?

Current research suggests distinct but complementary roles for TIM50's two domains. The core domain (aa 133-365) appears to be primarily responsible for interaction with Tim23, as mutations in this domain impair Tim50-Tim23 binding . In vitro studies have shown that the core domain can bind presequences independently, suggesting a role in initial preprotein recognition . Conversely, the presequence-binding domain (PBD, aa 366-476) is essential for yeast viability, as its deletion is lethal even when the core domain is present . This suggests the PBD may play a critical role in transferring preproteins from the TOM complex to the TIM23 channel or in the later stages of import . Advanced experiments using domain-specific depletion strains (termed "Core-down" and "PBD-down") combined with import assays and cross-linking experiments are being employed to test whether the PBD is crucial for transferring precursors from TOM to the core domain or vice versa . These complementary functions may explain why both domains are essential for TIM50 function in vivo.

What experimental evidence supports TIM50's role in pathological conditions like cardiomyopathy?

Recent research has uncovered a novel protective role for TIM50 in cardiac pathology. Studies found that TIM50 expression is significantly downregulated in both human dilated cardiomyopathy (DCM) hearts and experimentally induced hypertrophic murine hearts . To investigate the functional significance of this downregulation, researchers generated both global TIM50 knockout mice and cardiac-specific TIM50 overexpression mice . Cardiac function and hypertrophy were assessed using a comprehensive approach combining echocardiography, histological analysis, Western blot, and real-time PCR . The analysis of oxidative stress parameters in these models revealed a potential mechanism by which TIM50 regulates cardiac hypertrophy . This experimental evidence suggests that beyond its canonical role in mitochondrial protein import, TIM50 functions as a novel protective regulator in cardiac pathophysiology, opening new avenues for therapeutic interventions targeting mitochondrial import machinery in heart disease.

What strategies can overcome the challenges of expressing functional TIM50 domains for structural studies?

Expressing functional TIM50 domains for structural studies presents several challenges due to the protein's membrane association and complex domain organization. Successful approaches have included:

  • Domain-based expression: Rather than attempting to express the full-length protein, researchers have successfully expressed individual domains, such as the IMS domain (aa 133-365), which yielded the crystal structure resolved to 1.83Å . This approach circumvents issues with the transmembrane segments.

  • Fusion tags and solubility enhancers: The use of N-terminal His tags has proven effective for purification of recombinant TIM50, as demonstrated with the Pongo abelii recombinant protein .

  • Expression systems optimization: E. coli has been successfully employed for expression of the soluble domains , while yeast expression systems may be more appropriate for studies requiring native post-translational modifications or membrane integration.

  • Reconstitution strategies: For functional studies, reconstitution of purified domains in liposomes or nanodiscs can provide a membrane-like environment that better preserves native protein conformation and activity.

These approaches have enabled significant advances in structural studies of TIM50, though challenges remain in capturing the dynamic interactions between domains during the protein import process.

How can researchers effectively analyze the interactions between TIM50 and presequence-containing proteins?

Analyzing the interactions between TIM50 and presequence-containing proteins requires specialized techniques to capture often transient and dynamic binding events. Effective methodological approaches include:

  • Cross-linking experiments: Chemical cross-linking followed by mass spectrometry has successfully identified interaction interfaces between TIM50 and preproteins. Research has shown that TIM50 can be cross-linked to preproteins halted at the level of the TOM complex, demonstrating its role in early recognition of incoming preproteins .

  • In vitro binding assays: Studies have mapped the presequence-binding site to the C-terminal part of the IMS segment of TIM50 using purified components and synthetic presequence peptides .

  • Domain-specific functional assays: Using the "Core-down" and "PBD-down" strains allows researchers to test the specific contributions of each domain to preprotein binding and transfer .

  • Import kinetics measurements: Quantitative analysis of import rates in mitochondria depleted of TIM50 or expressing domain-specific mutants provides functional evidence of interaction defects .

  • Structural studies: The crystal structure of TIM50's IMS domain revealed a large groove as the putative binding site for presequences, guiding the design of structure-based interaction studies .

By combining these approaches, researchers can build a comprehensive understanding of how TIM50 recognizes, binds, and facilitates the transfer of diverse presequence-containing proteins during mitochondrial import.

What are the critical parameters to consider when designing experiments using Pongo abelii TIM50 in heterologous systems?

When designing experiments using recombinant Pongo abelii TIM50 in heterologous systems, researchers should consider several critical parameters:

  • Domain coverage: The commercially available recombinant protein covers amino acids 45-353 of the mature protein , which includes the core domain but lacks the complete PBD. Researchers should evaluate whether this coverage is sufficient for their specific experimental questions or if a full-length construct is required.

  • Species differences: While mitochondrial import machinery is generally well-conserved across species, subtle differences between Pongo abelii and other experimental systems (e.g., yeast, mouse, human) might affect interactions with partner proteins. Sequence alignment and functional validation are recommended when extrapolating across species.

  • Buffer conditions: The recombinant protein is provided in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . Researchers should consider whether these conditions are compatible with their experimental system or if buffer exchange is necessary.

  • Reconstitution protocol: Following the recommended reconstitution protocol (0.1-1.0 mg/mL in deionized sterile water with 5-50% glycerol for storage) is essential to maintain protein stability and function.

  • Functional validation: Before complex experiments, researchers should validate that the recombinant protein retains its native binding properties, particularly if studying interactions with presequences or other components of the import machinery.

By carefully considering these parameters, researchers can design robust experiments that leverage the advantages of the recombinant Pongo abelii TIM50 while accounting for its specific characteristics and limitations.

How might high-resolution structural studies of full-length TIM50 advance our understanding of mitochondrial protein import?

High-resolution structural studies of full-length TIM50 represent a significant frontier in mitochondrial biology research. While the structure of the IMS core domain has been resolved to 1.83Å , the complete protein—including its transmembrane segment and the critically important PBD—remains structurally uncharacterized. A full-length structure would reveal:

  • The spatial arrangement between the transmembrane domain and the IMS domains, providing insights into how TIM50 is anchored in the membrane and how this positioning affects its function.

  • The structural basis of the cooperation between the core domain and PBD, which function even when expressed separately , suggesting a modular organization with specific interaction interfaces.

  • Conformational changes that might occur during preprotein binding and transfer, potentially revealing the dynamic mechanism of protein handover from TOM to TIM23 complexes.

  • Novel interaction surfaces with other components of the import machinery, particularly the channel-forming Tim23 protein.

Advanced techniques such as cryo-electron microscopy combined with cross-linking mass spectrometry could overcome the challenges of membrane protein structural biology and provide unprecedented insights into the complete TIM50 architecture and its dynamic function in the mitochondrial import process.

What are potential therapeutic applications emerging from understanding TIM50's role in cardiac pathology?

The discovery that TIM50 functions as a protective regulator in cardiac pathology opens several promising therapeutic avenues:

  • Diagnostic biomarkers: The downregulation of TIM50 in human dilated cardiomyopathy and hypertrophic murine hearts suggests its potential use as a diagnostic or prognostic biomarker for cardiac dysfunction.

  • Gene therapy approaches: Cardiac-specific overexpression of TIM50 could potentially counteract pathological hypertrophy, as suggested by the protective effects observed in mouse models .

  • Small molecule modulators: Compounds that enhance TIM50 function or stability might provide cardioprotective effects by ensuring efficient mitochondrial protein import and reducing oxidative stress.

  • Targeted antioxidant strategies: Since oxidative stress appears to be a key mechanism by which TIM50 deficiency contributes to cardiac pathology , targeted antioxidant therapies might be particularly effective in patients with reduced TIM50 expression.

  • Mitochondrial medicine: Broader applications in mitochondrial medicine could emerge from understanding how defects in the import machinery contribute to disease, potentially extending beyond cardiac conditions to other tissues dependent on high mitochondrial function.

These therapeutic directions will require further research to fully elucidate the mechanistic links between TIM50 function, mitochondrial protein import efficiency, oxidative stress, and disease pathogenesis.

How might new genomic and proteomic technologies advance our understanding of TIM50 function across species?

Emerging genomic and proteomic technologies offer powerful approaches to expand our understanding of TIM50 function across evolutionary lineages:

  • Comparative genomics: Advanced sequencing and bioinformatic analyses across diverse species can reveal evolutionary conservation patterns of TIM50 domains, identifying critical functional regions maintained through natural selection and species-specific adaptations.

  • CRISPR-Cas9 screens: Genome-wide CRISPR screens in various cell types can identify genetic interactors of TIM50, revealing context-specific factors that modulate its function. This approach has already proven valuable in generating TIM50 knockout models .

  • Proximity labeling proteomics: Techniques such as BioID or APEX2 could identify the dynamic interactome of TIM50 in living cells, capturing transient interactions during active protein import that might be missed by traditional immunoprecipitation approaches.

  • Single-cell proteomics: Emerging single-cell proteomic technologies could reveal cell-type-specific variations in TIM50 expression, post-translational modifications, and interacting partners, particularly relevant in tissues with diverse cell populations.

  • Structural proteomics: Integrative approaches combining cross-linking mass spectrometry, hydrogen-deuterium exchange, and computational modeling could build comprehensive structural models of the entire TIM23 complex with TIM50 in different functional states.

These technologies promise to transform our understanding of TIM50 from a static component of the mitochondrial import machinery to a dynamic regulator whose function is finely tuned across different cellular contexts, developmental stages, and evolutionary lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.