Recombinant Pongo abelii Mitochondrial thiamine pyrophosphate carrier (SLC25A19)

What is SLC25A19 and what is its primary function?

SLC25A19 is a member of the solute carrier family of proteins that functions as a mitochondrial transporter. Its primary role is to transport thiamine pyrophosphate (TPP) into mitochondria, the energy-producing centers of cells. This transport occurs through an exchange mechanism with intramitochondrial ATP and/or ADP. TPP serves as an essential cofactor for several mitochondrial enzymes, particularly the alpha-ketoglutarate dehydrogenase complex involved in the citric acid cycle (Krebs cycle) . The proper functioning of this transport system is critical for normal cellular metabolism and is believed to play a significant role in brain development .

How is the Pongo abelii SLC25A19 protein structurally characterized?

The Pongo abelii mitochondrial thiamine pyrophosphate carrier is a 320-amino acid protein. The full-length recombinant protein (residues 1-320) can be expressed with an N-terminal His-tag in bacterial expression systems such as E. coli . The amino acid sequence is characterized by multiple transmembrane domains typical of mitochondrial carrier proteins, with the sequence: MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPNAKYH GILQASRQILQEEGPTAFWKGHIPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSV HFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLCHAVGTMYRSEGPQVFYKGLAP TLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLF KKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMF FWYEFFCNVFHCMNRTASQR .

How does SLC25A19 contribute to mitochondrial energy metabolism?

SLC25A19 plays a crucial role in mitochondrial energy metabolism by ensuring the availability of TPP within the mitochondrial matrix. TPP serves as an essential cofactor for key enzymes in energy metabolism, particularly the alpha-ketoglutarate dehydrogenase complex of the citric acid cycle . By transporting TPP into mitochondria, SLC25A19 facilitates the proper functioning of these enzymes, which catalyze critical reactions in cellular respiration and energy production. Disruption of this transport function can lead to impaired mitochondrial metabolism and energy deficiency, potentially resulting in severe pathological conditions, especially in highly energy-dependent tissues such as the brain .

What are the optimal conditions for reconstituting recombinant Pongo abelii SLC25A19 protein?

For optimal reconstitution of lyophilized recombinant Pongo abelii SLC25A19 protein, the following protocol is recommended:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom.

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

• Add glycerol to a final concentration of 5-50% (50% is recommended) to enhance stability.

• Aliquot the reconstituted protein for long-term storage at -20°C/-80°C .

It's important to note that repeated freeze-thaw cycles should be avoided to maintain protein integrity. Working aliquots can be stored at 4°C for up to one week .

How can SLC25A19 transport activity be measured in liposome-based assays?

Based on methodologies used for similar mitochondrial carriers, the transport activity of SLC25A19 can be measured using reconstituted liposome systems:

• Protein purification: Purify the recombinant SLC25A19 to >90% homogeneity using appropriate chromatography techniques.

• Liposome preparation: Prepare liposomes using a mixture of phospholipids (typically phosphatidylcholine) by sonication and freeze-thaw cycles.

• Protein reconstitution: Incorporate the purified SLC25A19 protein into liposomes using detergent-mediated reconstitution followed by removal of detergent with Bio-Beads or gel filtration.

• Transport assay: Preload liposomes with internal substrate (e.g., ATP or ADP) and initiate transport by adding external substrate (e.g., radiolabeled TPP).

• Measurement: At various time points, terminate transport by adding specific inhibitors or by rapid filtration. Quantify substrate uptake using scintillation counting for radiolabeled substrates .

This methodology allows for determination of kinetic parameters, substrate specificity, and inhibition profiles of the transporter.

How can researchers assess SLC25A19 gene expression and regulation?

SLC25A19 gene expression and regulation can be studied using several complementary approaches:

• Luciferase reporter assay: Construct an SLC25A19 promoter-luciferase reporter by cloning the full-length promoter region upstream of a luciferase gene. Transfect cells of interest with this construct along with a control plasmid (e.g., pRL-TK Renilla luciferase). After appropriate treatments, measure Renilla-normalized firefly luciferase activity using a dual luciferase assay system .

• Quantitative RT-PCR: Extract RNA from tissues or cells of interest, synthesize cDNA, and perform qPCR using SLC25A19-specific primers to quantify mRNA expression levels.

• Western blotting: Detect SLC25A19 protein levels using specific antibodies against the protein, enabling assessment of translational regulation.

• Chromatin immunoprecipitation (ChIP): Identify transcription factors binding to the SLC25A19 promoter region using ChIP followed by qPCR or sequencing.

These methods provide comprehensive insights into the transcriptional and post-transcriptional regulation of SLC25A19 under various physiological and pathological conditions.

What genetic mutations in SLC25A19 are associated with human diseases?

Several genetic mutations in SLC25A19 have been associated with human diseases:

• Amish lethal microcephaly: This condition is caused by a specific mutation (Gly177Ala or G177A) in which the amino acid alanine is substituted for glycine at position 177 of the SLC25A19 protein. This mutation interferes with the transport of thiamine pyrophosphate into mitochondria and disrupts the activity of the alpha-ketoglutarate dehydrogenase complex, resulting in abnormal brain development and elevated levels of alpha-ketoglutaric acid in urine .

• Leigh syndrome: SLC25A19 mutations have also been implicated in Leigh syndrome, a severe neurological disorder characterized by progressive loss of mental and movement abilities. The specific mutations and mechanisms involved in this association are still being investigated .

Understanding these genetic variants provides crucial insights into the physiological importance of SLC25A19 and offers potential targets for therapeutic interventions.

How do mutations in SLC25A19 affect transport function and mitochondrial metabolism?

Mutations in SLC25A19 can significantly impact transport function and mitochondrial metabolism through several mechanisms:

• Reduced transport efficiency: Mutations like G177A disrupt the protein's ability to efficiently transport TPP across the mitochondrial membrane, leading to intramitochondrial TPP deficiency .

• Impaired enzyme activity: TPP deficiency within mitochondria compromises the activity of TPP-dependent enzymes, particularly the alpha-ketoglutarate dehydrogenase complex of the citric acid cycle .

• Metabolic dysregulation: Disruption of the citric acid cycle due to impaired enzyme activity leads to accumulation of metabolic intermediates (e.g., alpha-ketoglutaric acid) and energy production deficits.

• Developmental consequences: In tissues with high energy demands, such as the developing brain, these metabolic disturbances can result in severe developmental abnormalities, as observed in Amish lethal microcephaly .

Research using knockout models has demonstrated that complete loss of Slc25a19 function causes mitochondrial TPP depletion, embryonic lethality, CNS malformations, and anemia, highlighting the critical role of this transporter in development and cellular metabolism .

How does Pongo abelii SLC25A19 compare to human and other primate orthologs?

Comparative analysis of Pongo abelii (orangutan) SLC25A19 with human and other primate orthologs reveals high sequence conservation, reflecting the evolutionary importance of this mitochondrial carrier. While specific comparative data for Pongo abelii SLC25A19 is limited in the provided search results, mitochondrial carrier proteins generally show strong functional conservation across species.

Further research using comparative functional assays with recombinant proteins from different species could provide valuable insights into the evolutionary adaptation of this critical transporter.

What are the implications of SLC25A19 in pancreatic acinar cell metabolism and pathology?

Research indicates that SLC25A19 plays a significant role in pancreatic acinar cell (PAC) metabolism and may be implicated in pancreatic pathology:

• Mitochondrial function in PACs: SLC25A19-mediated TPP transport is essential for normal mitochondrial function in pancreatic acinar cells, which have high energy demands due to their secretory activity.

• Response to environmental toxins: Studies have shown that exposure to environmental toxins like NNK (a tobacco-specific carcinogen) affects SLC25A19 expression in pancreatic cells. This was demonstrated using SLC25A19 promoter-luciferase reporter assays, which showed altered transcriptional activity following NNK exposure .

• Potential role in pancreatic diseases: Disruption of mitochondrial TPP transport may contribute to pancreatic disorders through energy metabolism dysregulation and increased susceptibility to cellular stress and inflammation.

These findings suggest that SLC25A19 could represent a potential therapeutic target for pancreatic disorders, particularly those associated with mitochondrial dysfunction or exposure to environmental toxins.