Recombinant Pongo abelii Mitochondrial uncoupling protein 2 (UCP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
UCP2; SLC25A8; Mitochondrial uncoupling protein 2; UCP 2; Solute carrier family 25 member 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGPVHATASAQYR GVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHASIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTS PNVARNAIVNCAELVTYDLIKDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA ACTSREAPF
Uniprot No.

Target Background

Function
Uncoupling proteins (UCPs) are mitochondrial transporter proteins that facilitate proton leakage across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. This results in energy dissipation in the form of heat.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Pongo abelii Mitochondrial uncoupling protein 2 (UCP2)?

Mitochondrial uncoupling protein 2 (UCP2) from Pongo abelii (Sumatran orangutan) is a transport protein belonging to the mitochondrial carrier family that is localized to the inner mitochondrial membrane. The full-length protein consists of 309 amino acids with a UniProt ID of Q5R5A8. The protein is also known by the alternative name "Solute carrier family 25 member 8" (SLC25A8) . UCP2 is involved in numerous physiological and pathological processes including insulin secretion, stem cell differentiation, cancer development, and aging processes. While initially thought to primarily function in uncoupling oxidative phosphorylation, recent research has demonstrated its specific role as a metabolite transporter that regulates substrate oxidation in mitochondria .

What is the primary function of UCP2 in cellular metabolism?

UCP2 functions as a specialized metabolite transporter that catalyzes the exchange of C4 metabolites (specifically malate, oxaloacetate, and aspartate) for phosphate plus a proton across the inner mitochondrial membrane. This transport activity effectively exports C4 metabolites from mitochondria to the cytosol, playing a critical regulatory role in cellular bioenergetics . Research has shown that UCP2 activity limits mitochondrial oxidation of glucose while enhancing glutaminolysis, thus providing a unique regulatory mechanism in energy metabolism. These findings explain the significance of UCP2 expression levels in metabolic reprogramming that occurs under various physiological and pathological conditions .

What are the optimal storage conditions for recombinant Pongo abelii UCP2 protein?

For long-term storage of recombinant Pongo abelii UCP2 protein, the following protocol is recommended:

  • Store the protein at -20°C to -80°C upon receipt

  • Aliquoting is necessary to avoid multiple freeze-thaw cycles

  • For extended storage, conserve at -20°C or -80°C

  • For working aliquots, store at 4°C for up to one week

  • Avoid repeated freezing and thawing as this can compromise protein integrity

The protein is typically provided in a storage buffer containing Tris-based buffer with 50% glycerol or Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which has been optimized for this specific protein .

How should recombinant UCP2 protein be reconstituted for experimental use?

The recommended reconstitution protocol for lyophilized recombinant UCP2 protein is:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

  • Aliquot for long-term storage at -20°C/-80°C

This reconstitution method ensures optimal protein stability and activity for subsequent experimental applications .

What experimental systems can be used to study UCP2 transport activity?

Several experimental systems have been validated for studying UCP2 transport activity:

  • Proteoliposome reconstitution: Recombinant UCP2 can be reconstituted into lipid vesicles to study substrate-specific transport. This system has successfully demonstrated UCP2-mediated exchange of malate, oxaloacetate, and aspartate for phosphate plus a proton .

  • Yeast expression systems: UCP2 can be expressed in Saccharomyces cerevisiae strains lacking endogenous mitochondrial transporters (such as the Pi/H+ symporter Mir1p). This allows for assessment of UCP2-specific transport activities in isolated yeast mitochondria .

  • Osmotic swelling assays: Isolated mitochondria containing UCP2 can be subjected to osmotic swelling experiments in solutions containing specific substrates (e.g., ammonium phosphate) to demonstrate transport activity .

  • Human cell lines: UCP2 function can be studied in human cell lines such as HepG2 cells using UCP2 silencing approaches, followed by measurements of mitochondrial membrane potential, ATP:ADP ratios, and metabolite levels .

How does UCP2 expression affect mitochondrial energetics?

UCP2 expression significantly impacts mitochondrial energetics through multiple mechanisms:

  • Membrane potential regulation: UCP2 expression is associated with lower inner mitochondrial membrane potential. Studies in HepG2 cells showed that UCP2 silencing resulted in higher membrane potential when cells were grown in glucose-containing media .

  • ATP production: UCP2 expression reduces the ATP:ADP ratio and more dramatically affects the energetic charge and ATP:AMP ratio, suggesting that UCP2 creates an energetic stress condition in the cell .

  • TCA cycle activity: UCP2 silencing leads to higher levels of citric acid cycle intermediates in mitochondria, indicating that UCP2 expression normally limits TCA cycle activity .

  • Substrate utilization: UCP2 expression promotes a metabolic shift, limiting glucose oxidation while enhancing glutamine utilization. This is evidenced by the higher lactate release in wild-type cells compared to UCP2-silenced cells when grown in glucose .

These effects demonstrate UCP2's critical role in regulating cellular bioenergetics and substrate preference, suggesting its involvement in metabolic reprogramming under various physiological and pathological conditions.

What is the relationship between UCP2 expression and cancer?

Research has revealed significant associations between UCP2 expression and cancer development:

  • Correlation with tumor grade: Studies have demonstrated a statistically significant association (P>0.001) between UCP2 expression and tumor grade in primary breast cancer. Higher UCP2 expression correlates with more aggressive, poorly differentiated tumors .

  • Regulation by TGFβ signaling: In well to moderately differentiated tumor cells, TGFβ signaling leads to SMAD recruitment to the UCP2 promoter, resulting in repression of gene transcription. In contrast, poorly differentiated tumor cells, which are often TGFβ resistant, show aberrant UCP2 regulation and consequently gene overexpression .

  • Cellular effects promoting tumor aggressiveness:

    • Reduced mitochondrial calcium

    • Facilitated maintenance of mitochondrial membrane potential

    • Decreased oxidative stress

    • Inhibited cell death

  • Therapeutic implications: UCP2 silencing in poorly differentiated tumor cells rapidly induces apoptosis and cell differentiation while reducing cell survival and proliferation. This suggests UCP2 as a potential therapeutic target in aggressive cancers .

These findings strongly suggest that assessment of UCP2 expression at clinical presentation could augment therapeutic decision-making and potentially improve patient outcomes through personalized targeting approaches.

How do UCP2 polymorphisms influence metabolic phenotypes?

UCP2 genetic variants have been associated with altered metabolic responses in humans:

  • UCP2 I/D polymorphism: This insertion/deletion polymorphism (rs1800795) has been found to modulate changes in body mass index (BMI) during lifestyle modification interventions .

  • Effect on lifestyle intervention outcomes: The influence of UCP2 I/D polymorphism on BMI changes during lifestyle modification was analyzed using multiple regression analysis. The results revealed significant differences in response to intervention based on genotype, as shown in the following table:

This data suggests that carriers of different UCP2 I/D genotypes respond differently to lifestyle modifications, with the DD genotype showing a stronger association with BMI changes compared to the DI+II genotypes .

What methods can be used to assess UCP2 transport activity in reconstituted systems?

To evaluate UCP2 transport activity in reconstituted proteoliposome systems, researchers can employ several methodological approaches:

  • Radioactive substrate uptake assays: This involves:

    • Reconstituting purified UCP2 protein into liposomes preloaded with unlabeled substrates

    • Initiating transport by adding radioactive substrates (e.g., radiolabeled phosphate, L-malate, or L-aspartate)

    • Measuring substrate uptake over time

    • Comparing with appropriate controls (e.g., liposomes without UCP2 or with a different carrier like UCP1)

  • Unidirectional transport assays: These can determine if transport can occur in the absence of an external counterion by:

    • Loading proteoliposomes with radioactive substrates

    • Measuring efflux of radioactive substrates into the external medium lacking counterions

    • Comparing with homo-exchange rates to establish transport mechanism

  • Osmotic swelling assays with reconstituted systems: This approach:

    • Reconstitutes UCP2 into liposomes

    • Measures volume changes spectrophotometrically in response to substrate gradients

    • Can distinguish between symport and exchange mechanisms

These methods have successfully demonstrated that UCP2 catalyzes the exchange of malate, oxaloacetate, and aspartate for phosphate plus a proton, establishing its specific transport function .

How can researchers effectively silence UCP2 expression to study its function?

Effective UCP2 silencing for functional studies can be achieved through multiple approaches:

  • siRNA-mediated silencing: This approach has been validated in human hepatocellular carcinoma (HepG2) cells, allowing researchers to compare:

    • Mitochondrial membrane potential

    • ATP:ADP ratio

    • Citric acid cycle intermediate levels

    • Lactate release

    • Substrate preference between wild-type and UCP2-silenced cells

  • Experimental validation of silencing: Researchers should confirm UCP2 silencing through:

    • Western blot analysis

    • qRT-PCR

    • Functional assays comparing physiological parameters before and after silencing

  • Controls and considerations:

    • Use of non-targeting siRNA controls

    • Testing multiple siRNA sequences targeting different regions of UCP2 mRNA

    • Consideration of cell-type specific effects

    • Validation of phenotypes with UCP2 reconstitution experiments

  • Alternative approaches:

    • CRISPR/Cas9-mediated knockout for complete UCP2 elimination

    • Inducible shRNA systems for temporal control of UCP2 expression

    • Use of UCP2-specific inhibitors as complementary approaches

These silencing methodologies have been instrumental in revealing UCP2's role in regulating substrate oxidation in mitochondria and its impact on cellular energetics .

What experimental approaches can detect UCP2-mediated metabolite transport in intact cells?

To investigate UCP2-mediated metabolite transport in intact cellular systems, researchers can employ these advanced experimental approaches:

  • Isotope tracing with mass spectrometry:

    • Culture cells with stable isotope-labeled substrates (e.g., 13C-glucose or 13C-glutamine)

    • Extract metabolites from cytosolic and mitochondrial fractions

    • Analyze metabolite labeling patterns using LC-MS/MS

    • Compare patterns between wild-type and UCP2-silenced cells to identify UCP2-dependent metabolite movements

  • Compartment-specific metabolite measurements:

    • Isolate mitochondrial and cytosolic fractions using cell fractionation techniques

    • Measure concentrations of UCP2 substrates (malate, oxaloacetate, aspartate, phosphate) in each fraction

    • Compare concentrations between wild-type and UCP2-manipulated cells

  • Real-time metabolite sensors:

    • Use genetically-encoded fluorescent sensors targeted to specific cellular compartments

    • Monitor substrate levels in different compartments in real-time

    • Observe changes in response to UCP2 manipulation

  • Metabolic flux analysis:

    • Measure changes in metabolic pathway activities using 13C metabolic flux analysis

    • Determine how UCP2 expression affects specific pathway fluxes

    • Validate with direct measurements of enzyme activities and metabolite levels

These approaches have revealed that UCP2 exports C4 metabolites from mitochondria to the cytosol, thereby regulating the balance between glucose and glutamine oxidation in cells .

How might the evolutionary conservation of UCP2 across primate species inform functional studies?

The evolutionary conservation of UCP2 across primate species provides valuable insights for functional studies:

  • Comparative sequence analysis: Researchers can compare Pongo abelii UCP2 (309 amino acids) with homologs from other primates, including humans. Highly conserved regions likely represent functionally critical domains for substrate binding, transport, or regulation .

  • Structure-function relationships: Conservation patterns can guide mutagenesis studies to identify:

    • Residues critical for substrate specificity

    • Regions involved in transport mechanism

    • Regulatory domains that respond to physiological signals

  • Species-specific differences: Identifying variations in UCP2 sequence or regulation between primate species may:

    • Reveal adaptations to different metabolic demands

    • Explain species-specific disease susceptibility

    • Provide insights into evolutionary pressures on mitochondrial metabolism

  • Translational relevance: The high conservation of UCP2 across primates suggests that findings from studies using Pongo abelii UCP2 may be directly applicable to human UCP2 function and associated diseases.

This evolutionary perspective enhances the interpretation of functional studies and guides targeted investigations of UCP2's role in human health and disease.

What are the critical considerations for designing experiments to study UCP2's role in metabolic reprogramming?

Researchers investigating UCP2's role in metabolic reprogramming should consider these critical experimental design factors:

  • Cell type selection and physiological relevance:

    • Different cell types show varying levels of UCP2 expression and metabolic profiles

    • Cancer cells often display altered UCP2 expression compared to normal cells

    • Primary cells may provide more physiologically relevant results than established cell lines

  • Substrate availability and utilization:

    • Experiments should test both glucose and glutamine as carbon sources

    • Measure the effects of UCP2 manipulation under different substrate conditions

    • Consider the influence of other nutrients like fatty acids that may affect UCP2 function

  • Temporal dynamics:

    • Acute vs. chronic UCP2 manipulation may yield different metabolic responses

    • Consider inducible systems for temporal control of UCP2 expression

    • Monitor metabolic adaptations over time following UCP2 alterations

  • Integration with signaling pathways:

    • Investigate interactions with TGFβ signaling, which regulates UCP2 expression in some cell types

    • Consider other regulatory pathways like AMPK and mTOR that respond to energetic stress

    • Explore how UCP2-mediated metabolic changes feed back to alter cellular signaling

  • Quantitative measurements of key parameters:

    • Mitochondrial membrane potential

    • ATP:ADP and ATP:AMP ratios

    • TCA cycle intermediate levels

    • Oxygen consumption rates with different substrates

    • Lactate production and release

These considerations will help researchers design robust experiments that accurately capture UCP2's complex role in metabolic regulation .

How can the understanding of UCP2 transport mechanism inform therapeutic strategies?

The detailed characterization of UCP2's transport mechanism provides several avenues for therapeutic development:

  • Cancer metabolism targeting:

    • UCP2 overexpression in aggressive cancers promotes metabolic reprogramming

    • Inhibiting UCP2-mediated transport could reverse the Warburg effect in cancer cells

    • Combination therapies targeting both UCP2 and glutamine metabolism may be particularly effective

    • The significant association between UCP2 expression and tumor grade suggests its potential as a prognostic biomarker

  • Metabolic disease interventions:

    • UCP2 polymorphisms influence responses to lifestyle interventions

    • Personalized dietary interventions based on UCP2 genotype could improve outcomes

    • Pharmacological modulation of UCP2 activity might enhance metabolic flexibility

  • Structure-based drug design:

    • Knowledge of UCP2's transport mechanism enables rational design of specific inhibitors

    • Targeting the substrate binding sites for C4 metabolites or phosphate could selectively modulate UCP2 function

    • Development of allosteric modulators that alter transport kinetics rather than completely blocking function

  • Biomarker development:

    • UCP2 expression levels or activity could serve as biomarkers for:

      • Cancer aggressiveness and treatment response

      • Metabolic disease risk and intervention efficacy

      • Cellular metabolic state in various pathological conditions

These therapeutic approaches leverage the understanding that UCP2 functions as a specific metabolite transporter rather than simply an uncoupling protein, allowing for more precise interventions targeting its role in pathological metabolic reprogramming .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.