Recombinant Pongo abelii Muscarinic acetylcholine receptor M1 (CHRM1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
CHRM1; Muscarinic acetylcholine receptor M1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-460
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETESRARELAALQGSETPGKGGGSSSS SERSQPGAEGSPGTPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through the action of G proteins. The primary transducing effect is Pi turnover.
Database Links
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for producing recombinant Pongo abelii CHRM1, and how do researchers validate their functionality?

Recombinant CHRM1 production requires expression systems that preserve its structural integrity and post-translational modifications. Mammalian systems, such as Chinese Hamster Ovary (CHO) cells, are widely used due to their ability to perform complex glycosylation and folding . For example, the CHO-CHRM1 cell line expresses human CHRM1 via recombinase-mediated cassette exchange (RMCE), ensuring stable and controlled receptor production . Insect cell systems (e.g., Sf9) are alternatives but may lack mammalian-specific modifications.

Validation methodology:

  • Radioligand binding assays using antagonists like pirenzepine (M1-selective) to confirm ligand-binding affinity.

  • Functional assays measuring G-protein-coupled responses (e.g., cAMP inhibition or calcium mobilization via phospholipase C activation) .

  • Immunoblotting with anti-CHRM1 antibodies to verify protein size (∼51 kDa) and glycosylation status .

How do researchers assess the purity and post-translational modifications of recombinant CHRM1?

Purity is critical for structural and functional studies. Size-exclusion chromatography (SEC) and SDS-PAGE are standard methods, with ≥95% purity required for crystallography . Post-translational modifications are analyzed via:

  • Mass spectrometry to identify phosphorylation sites (e.g., Ser/Thr residues in the third intracellular loop) and glycosylation patterns.

  • Enzymatic deglycosylation (e.g., PNGase F treatment) to distinguish N-linked glycans .

For example, the recombinant CHRM1 from Pongo abelii (UniProt Q5R949) contains a 460-amino-acid sequence with predicted glycosylation at Asn2 and Asn12 .

What in vitro assays are used to characterize CHRM1 signaling pathways?

Key assays include:

  • Calcium imaging: CHRM1 activates Gq/11-coupled pathways, increasing intracellular Ca²⁺. Fluorescent dyes (e.g., Fluo-4) quantify responses to agonists like carbachol .

  • cAMP inhibition assays: Co-transfection with cAMP biosensors (e.g., GloSensor) measures Gi/o-mediated suppression of adenylate cyclase .

  • β-arrestin recruitment assays (e.g., BRET/FRET) to study biased signaling .

How do structural variations in CHRM1 between species impact translational research?

Pongo abelii CHRM1 shares 98% homology with human CHRM1 but differs at residues critical for ligand specificity (e.g., Leu112 in transmembrane domain 3) . Researchers address this by:

  • Molecular dynamics simulations comparing ligand-binding pockets.

  • Chimeric receptor studies swapping domains between species to isolate functional regions .

For example, bluegill M5 receptor studies revealed that non-mammalian models require careful extrapolation due to divergent signaling pathways .

What strategies resolve contradictory data in CHRM1-mediated gene expression studies?

Discrepancies arise from model system limitations (e.g., Chrm1−/− mice vs. human postmortem tissue). Solutions include:

  • Cross-species transcriptomics: Compare cortical gene expression in Chrm1−/− mice with human schizophrenia datasets . Overlap in pathways like mitochondrial dysfunction (e.g., COX6A1 downregulation) strengthens validity .

  • Dose-response analyses using partial agonists (e.g., xanomeline) to distinguish linear vs. biphasic signaling effects.

How is recombinant CHRM1 used to model neuropsychiatric disorders?

CHRM1 deficits are implicated in schizophrenia and Alzheimer’s disease . Advanced models include:

  • Induced pluripotent stem cell (iPSC)-derived neurons: Edit CHRM1 expression via CRISPR/Cas9 and assay dendritic arborization deficits.

  • Transgenic mice with conditional CHRM1 knockout in cortical pyramidal neurons to isolate cognitive phenotypes .

Table 1: Comparison of CHRM1 Expression Systems

ParameterCHO Cells Insect CellsHEK293
Yield1–2 mg/L3–5 mg/L0.5–1 mg/L
GlycosylationComplex, mammalianPaucimannoseHybrid
Functional AssaysYes (Gq coupling)Limited (no arrestin recruitment)Yes (transient transfection)

Table 2: Key CHRM1 Signaling Assays

AssayReadoutThroughputRelevance to Disease Models
Calcium mobilizationΔF/F0 (Fluo-4)MediumSchizophrenia (PLC pathway)
cAMP inhibitionLuminescence (GloSensor)HighAlzheimer’s (AC suppression)
β-arrestin recruitmentBRET ratioLowDrug bias (antipsychotics)

Data Contradiction Analysis Framework

  • Identify confounding variables: In Chrm1−/− mice, compensatory upregulation of CHRM3 may mask cognitive deficits .

  • Leverage multi-omics: Integrate RNA-seq data from knockout models with proteomics of postmortem tissue to filter false positives.

  • Validate in human cells: Use iPSC-derived neurons treated with CHRM1-positive allosteric modulators (e.g., BQCA) to confirm conserved pathways .

Ethical and Technical Considerations

  • Species-specific ethics: Pongo abelii is endangered; recombinant systems reduce reliance on native tissues .

  • Signal transduction bias: Antibody validation is critical, as commercial anti-CHRM1 antibodies often cross-react with CHRM3 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.