Recombinant Pongo abelii Myelin-oligodendrocyte glycoprotein (MOG)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Pongo abelii Myelin-Oligodendrocyte Glycoprotein (MOG) is a synthetically produced version of the MOG protein found in the Sumatran orangutan (Pongo abelii) . MOG is a crucial component of the myelin sheath, which insulates nerve fibers in the central nervous system (CNS) . Recombinant MOG proteins are valuable tools in studying autoimmune demyelinating diseases, particularly multiple sclerosis (MS) .

Structure and Characteristics

MOG is a glycoprotein belonging to the immunoglobulin superfamily and is exclusively expressed in the CNS . Although MOG accounts for only a small fraction (0.01-0.05%) of the total CNS myelin proteins, it plays a significant role as an autoantigen in MS in humans, as well as in experimental autoimmune encephalomyelitis (EAE) models in rodents and monkeys .

Recombinant human MOG (H-rMOG) consists of the extracellular domain of human MOG, along with a 6x His tag, and is expressed in E. coli . It is purified from urea-denatured bacterial lysate using immobilized metal affinity chromatography (IMAC) . The molecular mass of recombinant human MOG is approximately 14.2 kDa .

Role in Autoimmune Demyelination

In MS, the immune system mistakenly attacks the myelin sheath, leading to demyelination and neurological dysfunction . MOG is a major target of this autoimmune response . Antibodies against MOG are found in a significant percentage of MS patients, suggesting its involvement in the disease process . Studies have indicated that 38% of MS patients are seropositive for IgG antibodies to MOG-Ig . This immune response is also observed in other inflammatory neurological diseases (OIND), but the anti-MOG-Ig antibodies tend to be transient in OIND, whereas they persist in MS .

Experimental Autoimmune Encephalomyelitis (EAE)

EAE is an animal model widely used to study MS . Immunization with recombinant MOG can induce EAE in rodents and monkeys, mimicking the demyelination and inflammation seen in MS . Studies using recombinant human MOG-induced EAE in common marmosets have shown a 100% disease incidence, a chronic disease course, and variable time intervals between immunization and neurological impairment .

Research has indicated that the specificity diversification of anti-MOG T cells is wider in monkeys with fast disease progression compared to those with slow progression . Specifically, the MOG(34-56) peptide has been identified as a critical encephalitogenic peptide capable of inducing severe neurological disease with inflammation, demyelination, and axonal injury in the CNS .

Applications in Research

Recombinant MOG proteins are used in various research applications:

  • ELISA assays: Recombinant Pongo abelii MOG is used in enzyme-linked immunosorbent assays (ELISA) to detect and quantify anti-MOG antibodies in serum and cerebrospinal fluid .

  • Induction of EAE: As mentioned, recombinant MOG is used to induce EAE in animal models to study the pathogenesis of MS and to test potential therapies .

  • T cell and B cell response studies: Recombinant MOG is used to investigate T cell and B cell responses against MOG epitopes in MS patients and EAE models .

  • Development of diagnostic tools: The use of recombinant MOG has the potential to improve diagnostic methods for MS and related demyelinating diseases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MOG; Myelin-oligodendrocyte glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-246
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
MOG
Target Protein Sequence
GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGE QAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFY WVSPGVLVLLAVLPVLLLQIAVGLVFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKI TLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Uniprot No.

Target Background

Function

A minor component of the myelin sheath, this protein may be involved in myelin sheath formation and maintenance, as well as in cell-cell communication. It mediates homophilic cell-cell adhesion.

Database Links
Protein Families
Immunoglobulin superfamily, BTN/MOG family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Pongo abelii MOG and why is it significant for comparative research?

Pongo abelii (Sumatran orangutan) MOG is a myelin-oligodendrocyte glycoprotein from a non-human primate species closely related to humans. This protein plays a critical role in the structural integrity of myelin sheaths in the central nervous system (CNS). The study of MOG from Pongo abelii offers valuable comparative insights for researchers investigating evolutionary conservation of myelin proteins and autoimmune demyelinating disorders.

The full-length mature Pongo abelii MOG protein spans amino acids 29-246 and contains essential domains for its biological function . Comparative analysis between Pongo abelii MOG and human MOG can reveal evolutionary adaptations in myelin structure and function. This comparative approach is particularly valuable for understanding both conserved mechanisms and species-specific differences in myelin biology that may inform human disease research.

What expression systems are recommended for producing recombinant Pongo abelii MOG?

Expression SystemAdvantagesLimitationsYield
Standard E. coliCost-effective, rapid growthOften produces insoluble protein requiring refoldingVariable
SHuffle E. coliEnhanced disulfide bond formation, improved solubilityHigher cost than standard strains>100 mg/L for human MOG
Mammalian cellsProper post-translational modificationsExpensive, lower yield, time-consumingLower than bacterial systems
Insect cellsBetter folding than E. coli, higher yield than mammalianIntermediate cost, different glycosylation patternModerate

For researchers prioritizing protein solubility and proper disulfide bond formation, specialized E. coli strains like SHuffle cells can dramatically improve yield of soluble protein, as demonstrated with human MOG . This approach combines the advantages of bacterial expression (high yield, speed) with improved protein folding capabilities.

How can I optimize expression of soluble recombinant Pongo abelii MOG?

Optimizing soluble expression of recombinant Pongo abelii MOG requires addressing several key factors:

  • Expression strain selection: SHuffle cells represent a significant advancement for MOG expression as they facilitate disulfide bond formation in the bacterial cytoplasm, which is critical for proper MOG folding . These engineered E. coli strains have been shown to produce high yields of soluble human MOG (>100 mg/L), and similar results could be expected for Pongo abelii MOG.

  • Expression temperature optimization: Lowering the expression temperature (16-25°C) after induction can significantly improve protein solubility by slowing protein synthesis and allowing more time for proper folding.

  • Induction parameters: Optimizing IPTG concentration (typically 0.1-0.5 mM) and induction duration (4-16 hours) can dramatically improve soluble protein yield.

  • Buffer formulation: The protein appears to be stable in Tris/PBS-based buffers with 6% trehalose at pH 8.0 , which helps maintain protein solubility during purification and storage.

  • Fusion tags: The N-terminal His-tag approach documented for Pongo abelii MOG facilitates purification while maintaining protein function . Alternative fusion partners like MBP (maltose-binding protein) could further enhance solubility if needed.

The combination of these optimization strategies can transform a poorly expressed, insoluble protein into a high-yield, soluble product suitable for downstream applications.

What purification strategies are most effective for recombinant Pongo abelii MOG?

A multi-step purification strategy is typically required to obtain high-purity recombinant Pongo abelii MOG suitable for research applications:

  • Initial capture: For His-tagged MOG, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin serves as an effective first purification step . Optimized binding and washing buffers containing 20-40 mM imidazole can reduce non-specific binding while maintaining target protein binding.

  • Intermediate purification: Size exclusion chromatography (SEC) effectively separates monomeric MOG from aggregates and contaminants of different molecular sizes. SEC-MALS (multi-angle light scattering) can simultaneously confirm protein homogeneity and monomeric state .

  • Polishing step: Ion exchange chromatography may be employed as a final polishing step to remove closely related impurities based on charge differences.

  • Quality control: The purity should exceed 90% as determined by SDS-PAGE . Additional validation through Western blotting, mass spectrometry, and differential scanning fluorimetry can confirm protein identity and proper folding.

For researchers working with MOG for immunological studies, it's critical to remove endotoxin contamination using specialized endotoxin removal techniques, as bacterial lipopolysaccharides can significantly confound immunological assays.

What storage and handling recommendations ensure optimal stability of recombinant Pongo abelii MOG?

Proper storage and handling are crucial for maintaining the structural integrity and activity of recombinant Pongo abelii MOG:

  • Short-term storage: For working aliquots, store at 4°C for up to one week to minimize freeze-thaw damage .

  • Long-term storage: Store the lyophilized protein at -20°C to -80°C. After reconstitution, add glycerol (to a final concentration of 5-50%, with 50% being optimal) and store as aliquots at -20°C or -80°C .

  • Reconstitution protocol:

    • Centrifuge the vial briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol for long-term storage

    • Create single-use aliquots to avoid repeated freeze-thaw cycles

  • Stability considerations: Avoid repeated freeze-thaw cycles as they can lead to protein denaturation and aggregation. If working with the protein regularly, maintain a working aliquot at 4°C and keep the remaining stock frozen.

The addition of stabilizing agents like trehalose (6% in the storage buffer) significantly enhances protein stability during freeze-thaw cycles and lyophilization by preventing protein denaturation through preferential hydration and water replacement mechanisms.

How can recombinant Pongo abelii MOG be utilized in experimental autoimmune encephalomyelitis (EAE) models?

Recombinant Pongo abelii MOG can serve as a valuable tool in EAE models, which are widely used to study demyelinating diseases such as multiple sclerosis (MS) and MOG antibody-associated disease (MOGAD). Key methodological considerations include:

  • Immunization protocol: The extracellular domain of MOG contains both B and T cell epitopes critical for inducing EAE. Typically, 100-200 μg of protein is emulsified in complete Freund's adjuvant and administered subcutaneously to susceptible mouse strains.

  • B cell-dependent model development: Similar to human MOG, Pongo abelii MOG can potentially induce B cell-dependent EAE in mice . This model is particularly valuable for studying the antibody-mediated components of demyelinating diseases.

  • Cross-species reactivity assessment: Evaluating the cross-reactivity of anti-MOG antibodies between Pongo abelii and human MOG provides important insights into epitope conservation and antibody specificity. This can be done through competitive binding assays or epitope mapping studies.

  • T cell response evaluation: In vitro proliferation assays using purified MOG can determine if the protein can be processed and recognized by T cells expressing TCRs specific for MOG epitopes, similar to what has been demonstrated with human MOG .

  • Comparative pathology analysis: Comparing the pathological features of EAE induced by Pongo abelii MOG versus human MOG can reveal species-specific differences in immune recognition and disease mechanisms.

When designing such experiments, it's essential to include appropriate controls, such as B cell-deficient mice, to confirm the B cell dependency of the model, as demonstrated in human MOG studies .

What analytical methods best characterize the structural properties of recombinant Pongo abelii MOG?

Comprehensive structural characterization of recombinant Pongo abelii MOG requires a multi-technique approach:

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): This technique provides critical information about protein homogeneity, molecular weight, and oligomeric state. A homogeneous monomeric profile indicates properly folded protein suitable for structural and functional studies .

  • Differential scanning fluorimetry (DSF): DSF measures the protein's thermal stability by monitoring unfolding as temperature increases. A high melting temperature suggests a well-folded, stable protein structure . This technique can also assess the impact of buffer conditions and ligand binding on protein stability.

  • Circular dichroism (CD) spectroscopy: CD provides information about secondary structure content (α-helices, β-sheets) and can confirm proper protein folding.

  • Nuclear magnetic resonance (NMR) spectroscopy or X-ray crystallography: These techniques provide atomic-level structural information, although they require significant protein quantities and specialized expertise.

  • Epitope mapping using monoclonal antibodies: Comparing the binding patterns of conformation-sensitive antibodies to Pongo abelii MOG versus human MOG can reveal structural similarities and differences in immunologically relevant epitopes.

The combination of these techniques provides a comprehensive assessment of protein structure, stability, and functional integrity, which is essential for interpreting downstream experimental results.

How does recombinant Pongo abelii MOG compare functionally to human MOG in experimental settings?

Functional comparisons between Pongo abelii and human MOG reveal important species-specific differences and similarities:

  • Antibody cross-reactivity: Antibodies raised against human MOG may show varying degrees of cross-reactivity with Pongo abelii MOG depending on epitope conservation. This cross-reactivity can be systematically evaluated using techniques like ELISA, surface plasmon resonance, or cell-based assays with transfected cells expressing different MOG variants.

  • T cell epitope recognition: Assessing whether T cells expressing TCRs specific for human MOG epitopes (particularly the immunodominant MOG 35-55 peptide) can recognize Pongo abelii MOG provides insights into T cell epitope conservation . This can be evaluated through proliferation assays using T cells from transgenic mice or human T cell clones.

  • EAE induction comparison: Comparative studies of EAE induction using equivalent doses of human and Pongo abelii MOG can reveal differences in disease course, severity, and pathological features. Such comparisons should consider:

    • Disease onset timing

    • Maximum clinical score

    • Histopathological features

    • B and T cell infiltration patterns

    • Demyelination extent

  • Receptor binding studies: Evaluating the interaction of Pongo abelii MOG with its putative receptors or binding partners compared to human MOG can reveal functional similarities or differences at the molecular level.

These comparative studies provide valuable insights into the functional conservation of MOG across closely related primate species and enhance our understanding of MOG-related neurological disorders.

How can I address solubility issues with recombinant Pongo abelii MOG?

Solubility challenges are common when working with recombinant MOG proteins. Several strategies can help overcome these issues:

  • Specialized expression systems: Using SHuffle E. coli strains for expression can dramatically improve solubility by facilitating disulfide bond formation in the cytoplasm, eliminating the need for inefficient denaturation and refolding procedures .

  • Solubility-enhancing fusion partners: If solubility remains problematic, consider alternative fusion tags such as:

    • MBP (maltose-binding protein)

    • SUMO (small ubiquitin-like modifier)

    • Thioredoxin
      These can be added to the N-terminus in place of or alongside the His-tag.

  • Co-expression with chaperones: Co-expressing molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) can enhance protein folding and solubility in E. coli.

  • Buffer optimization: Systematic screening of buffer conditions can identify formulations that enhance solubility:

    • pH screening (typically pH 7.0-8.5)

    • Salt concentration (100-500 mM NaCl)

    • Addition of stabilizing agents (glycerol 5-10%, trehalose 5-10%)

    • Detergents at concentrations below critical micelle concentration

  • Protein engineering approaches: If specific regions contribute to aggregation, consider expressing truncated constructs containing only the extracellular domain or introducing stabilizing mutations based on structural information.

The combined approach of using specialized expression strains, optimized induction conditions, and carefully formulated buffers can transform a largely insoluble protein into a predominantly soluble one, greatly simplifying purification and enhancing yield.

What methods can verify proper folding and biological activity of recombinant Pongo abelii MOG?

Confirming the proper folding and biological activity of recombinant Pongo abelii MOG is critical for research applications:

  • Conformational antibody binding: Testing the reactivity of conformation-sensitive antibodies that recognize properly folded MOG epitopes provides a straightforward assessment of correct protein folding.

  • Thermal stability analysis: Differential scanning fluorimetry (DSF) provides a melting temperature (Tm) that correlates with protein stability. A high Tm indicates a well-folded, stable protein structure .

  • Functional binding assays: Assessing the binding of recombinant MOG to its natural binding partners or receptors confirms biological activity. This can be done using techniques like surface plasmon resonance (SPR) or bio-layer interferometry (BLI).

  • In vitro T cell recognition: Confirming that the purified MOG can be processed and recognized by MOG-specific T cells (as has been demonstrated for human MOG) verifies that the protein maintains biologically relevant epitopes . This can be tested using:

    • T cell proliferation assays

    • Cytokine production assays

    • TCR signaling assays

  • In vivo EAE induction: The ultimate functional test is the protein's ability to induce experimental autoimmune encephalomyelitis when used for immunization. This confirms that the protein contains the necessary B and T cell epitopes in their proper conformations .

These complementary approaches provide a comprehensive assessment of protein quality, from basic structural integrity to complex biological function, ensuring that experimental results accurately reflect the biology of interest.

How should researchers interpret contradictory results between Pongo abelii MOG and human MOG studies?

When encountering contradictory results between studies using Pongo abelii MOG and human MOG, researchers should consider several potential explanations:

  • Sequence and structural differences: Despite high homology, subtle amino acid differences between Pongo abelii and human MOG may affect epitope structure, antibody binding, or receptor interactions. Careful sequence alignment and structural modeling can identify potentially significant variations.

  • Expression system influences: Different expression systems (E. coli vs. mammalian cells) may result in proteins with different post-translational modifications or folding characteristics, affecting function and immunogenicity.

  • Protein quality variables: Differences in protein purity, aggregation state, or folding quality can significantly impact experimental outcomes. Standardized analytical techniques (SEC-MALS, DSF) should be employed to ensure comparable protein quality .

  • Experimental design considerations: Variations in experimental protocols, including:

    • Immunization protocols (adjuvant, dose, route)

    • Animal models (strain, age, sex)

    • Assay conditions (buffer composition, incubation time)
      may contribute to seemingly contradictory results.

  • Species-specific immune response differences: The immune response to Pongo abelii MOG versus human MOG may differ due to subtle variations in how the proteins are processed and presented by antigen-presenting cells or recognized by T and B cells.

To address these contradictions, researchers should conduct direct comparative studies using both proteins under identical experimental conditions, with appropriate controls and robust statistical analysis. This approach can reveal true biological differences versus methodological artifacts.

How might comparative studies of Pongo abelii MOG advance our understanding of human demyelinating disorders?

Comparative studies of Pongo abelii MOG offer unique opportunities to advance our understanding of human demyelinating disorders through evolutionary and translational insights:

  • Epitope conservation analysis: Mapping conserved versus divergent epitopes between Pongo abelii and human MOG can identify immunologically critical regions that have been maintained through evolution. These conserved regions likely represent functionally important domains that could serve as therapeutic targets.

  • Cross-species antibody reactivity profiling: Systematically testing patient-derived anti-MOG antibodies for cross-reactivity with Pongo abelii MOG can reveal patterns of epitope recognition associated with specific clinical phenotypes in MOG antibody-associated disease (MOGAD).

  • Evolutionary immunology insights: Comparing the immunogenicity of Pongo abelii and human MOG in various animal models can provide insights into how subtle sequence variations modulate immune responses, potentially revealing mechanisms of immune tolerance and autoimmunity.

  • Structural biology applications: Co-crystallization studies of Pongo abelii MOG with therapeutic antibodies or binding partners could reveal structural details relevant to human MOG interactions, especially if human MOG proves difficult to crystallize.

  • Novel model development: Developing transgenic mouse models expressing Pongo abelii MOG could provide new tools for studying MOG-related disorders and testing therapeutic approaches that might be applicable to human disease.

These comparative approaches leverage the evolutionary relationship between orangutans and humans to enhance our understanding of MOG biology in health and disease, potentially leading to new diagnostic and therapeutic strategies.

What novel methodologies are emerging for recombinant MOG protein production and analysis?

Several cutting-edge methodologies are transforming the field of recombinant MOG protein production and analysis:

  • Cell-free protein synthesis systems: These bypass the limitations of cellular expression by using purified transcription and translation machinery in vitro, potentially offering:

    • Rapid production (hours versus days)

    • Direct incorporation of non-natural amino acids

    • Simplified production of toxic proteins

  • Nanobody and single-domain antibody development: These smaller antibody fragments derived from camelids or engineered from conventional antibodies offer advantages for MOG epitope mapping and structural studies:

    • Better access to cryptic epitopes

    • Improved crystallization properties

    • Potential for intracellular expression

  • Cryo-electron microscopy (cryo-EM): This rapidly advancing structural biology technique can determine protein structures at near-atomic resolution without the need for crystallization, potentially revealing MOG structural details in different conformational states.

  • Native mass spectrometry: This technique allows analysis of intact protein complexes, providing insights into MOG oligomerization, binding partners, and conformational states under near-native conditions.

  • Single-molecule techniques: Methods such as single-molecule FRET (smFRET) and atomic force microscopy (AFM) can provide unique insights into MOG dynamics and interactions at the individual molecule level.

These emerging technologies complement traditional approaches and offer new possibilities for understanding MOG structure, function, and role in demyelinating disorders, potentially accelerating the development of targeted therapeutics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.