Recombinant Pongo abelii NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (NDUFB4)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Pongo abelii NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (NDUFB4) is a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase, also known as Complex I. Complex I is responsible for transferring electrons from NADH to ubiquinone in the respiratory chain . NDUFB4 is considered an accessory subunit, meaning it is not directly involved in the catalytic activity of Complex I .

Basic Information

CharacteristicDescription
SpeciesPongo abelii (Sumatran orangutan)
SynonymsNDUFB4, Complex I-B15, CI-B15, NADH-ubiquinone oxidoreductase B15 subunit
FunctionAccessory subunit of mitochondrial Complex I; not believed to be involved in catalysis
RoleElectron transfer from NADH to the respiratory chain with ubiquinone as the immediate electron acceptor
Amino Acid Length129 aa

Protein Information

Recombinant full-length Pongo abelii NDUFB4 protein is expressed in E. coli with an N-terminal His tag .

Specific details include :

  • Source: E. coli

  • Tag: His-tagged

  • Protein Length: Full Length of Mature Protein (2-129aa)

  • Form: Lyophilized powder

  • Purity: Greater than 90% as determined by SDS-PAGE

  • Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

The amino acid sequence is:
SFPKYKPSRLSPLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIE NPALLRWAYARTTNVYPNFRPTPKNSLMGALYGFGPLIFIYYIIKTERDRKEKLIQEGKL DRTFHLSY

Interactions and Functions

NDUFB4 is an accessory subunit of Complex I, which functions in the transfer of electrons from NADH to the respiratory chain, using ubiquinone as the electron acceptor . Although NDUFB4 is not thought to be directly involved in catalysis, it is essential for the proper function and assembly of Complex I .

NDUFB4 interacts with other subunits of Complex I, including NDUFA11, NDUFS3, NDUFA2, NDUFS6, NDUFS4, NDUFB9, NDUFA6, NDUFA5, NDUFB8, and NDUFB3 .

Role in Disease

While NDUFS4 is the most studied Complex I subunit in the context of mitochondrial diseases, research indicates that NDUFB4 expression does not change consistently in conditions such as diabetic kidney disease (DKD) . This suggests that NDUFB4 may not play as central a role in the pathogenesis of DKD as other subunits like NDUFS4 . NDUFS4 regulates cristae remodeling in diabetic kidney disease .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NDUFB4; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4; Complex I-B15; CI-B15; NADH-ubiquinone oxidoreductase B15 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-129
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
SFPKYKPSRLSPLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIE NPALLRWAYARTTNVYPNFRPTPKNSLMGALYGFGPLIFIYYIIKTERDRKEKLIQEGKL DRTFHLSY
Uniprot No.

Target Background

Function
Recombinant *Pongo abelii* NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (NDUFB4) is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to not be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the enzyme's immediate electron acceptor.
Database Links
Protein Families
Complex I NDUFB4 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is NDUFB4 and what is its role in mitochondrial function?

NDUFB4 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4) is an accessory subunit of Complex I (NADH dehydrogenase) within the mitochondrial respiratory chain. While this 15 kDa protein composed of 129 amino acids was initially believed not to be directly involved in the catalytic function of transferring electrons from NADH to ubiquinone, recent research has revealed its critical role in respiratory supercomplex formation .

The structure of NDUFB4 is characterized by an N-terminal hydrophobic domain that folds into an alpha helix spanning the inner mitochondrial membrane, with a C-terminal hydrophilic domain that interacts with globular subunits of Complex I . This two-domain structure is highly conserved, suggesting its fundamental importance for protein function.

Research methodology for studying NDUFB4 function includes:

  • Blue-native PAGE (BN-PAGE) to analyze native protein complexes

  • Point mutation analysis of specific residues (particularly N24 and R30)

  • Respirometry assays to measure oxygen consumption

  • Metabolomic analysis to assess downstream effects

How is NDUFB4 structurally organized within Complex I?

NDUFB4 is one of approximately 31 hydrophobic subunits forming the transmembrane region of Complex I . Complex I has an L-shaped structure consisting of:

  • A hydrophobic membrane arm embedded in the inner mitochondrial membrane

  • A hydrophilic matrix arm protruding into the mitochondrial matrix

NDUFB4 is specifically located in the membrane arm of Complex I, within the P_D (distal) module . This positioning is strategically important as it enables NDUFB4 to interact with subunits from Complex III, particularly UQCRC1, facilitating the formation of respiratory supercomplexes .

Complex I ModuleLocationCo-regulation LevelFunction
N moduleMatrix armHigh (r=0.68)NADH binding
Q moduleJunctionMedium (r=0.50)Ubiquinone binding
P module (includes NDUFB4)Membrane armMedium (r=0.49)Proton pumping

The highly conserved two-domain structure of NDUFB4 suggests that this feature is critical for anchoring the NADH dehydrogenase complex at the inner mitochondrial membrane .

What methods are used to study recombinant NDUFB4 from Pongo abelii?

Multiple methodological approaches are employed in studying recombinant Pongo abelii NDUFB4:

  • Protein Expression and Purification: Commercial recombinant protein production typically utilizes bacterial or yeast expression systems with subsequent purification using affinity chromatography . For example, the recombinant NDUFB4 protein from Pongo abelii described in source is supplied in a Tris-based buffer with 50% glycerol and recommended storage at -20°C.

  • Functional Assays: To assess NDUFB4 function, researchers employ:

    • CRISPR/Cas9 gene editing to create knockout models

    • Rescue experiments with wild-type or mutant versions

    • Seahorse XF analysis to measure cellular respiration

    • Blue-native PAGE to analyze protein complex formation

  • Structural Studies: Techniques like cryo-electron microscopy help resolve molecular interactions between NDUFB4 and other complex subunits.

  • Evolutionary Analysis: Methods described in source employ statistical models of codon evolution allowing for independent variation of synonymous and nonsynonymous rates to study protein evolution across species.

How should researchers design experiments to investigate NDUFB4's role in supercomplex formation?

Based on methodologies employed in recent research , a comprehensive experimental approach should include:

  • Generate Cellular Models:

    • Create NDUFB4 knockout cell lines using CRISPR/Cas9

    • Establish rescue cell lines with:

      • Wild-type NDUFB4 (positive control)

      • Point mutations at key residues (N24A, R30A)

      • C-terminal FLAG tags for detection

  • Assess Supercomplex Assembly:

    • Perform blue-native PAGE of digitonin-solubilized membrane proteins

    • Conduct immunoblot analysis using antibodies against:

      • NDUFA9 (Q module subunit)

      • NDUFB10 (P_D module subunit)

      • UQCRC1 (Complex III subunit)

  • Evaluate Respiratory Function:

    • Measure oxygen consumption rates (OCR) using Seahorse XF analyzer

    • Assess basal, leak, maximal, and ATP-linked respiration

    • Evaluate pathway-specific respiration by stimulating:

      • Complex I-specific OXPHOS (N-pathway)

      • Complex II-specific OXPHOS (S-pathway)

      • Combined CI+CII-linked OXPHOS

  • Analyze Metabolic Consequences:

    • Perform steady-state metabolomics to assess citric acid cycle intermediates

    • Measure activities of key metabolic enzymes (citrate synthase, malate dehydrogenase)

    • Determine glycolytic flux and metabolic flexibility

This integrated approach allows for comprehensive characterization of NDUFB4's role in supercomplex formation and its impact on cellular bioenergetics.

What role does NDUFB4 play in respiratory supercomplex formation?

Recent research has revealed that NDUFB4 is critical for the assembly and stability of respiratory supercomplexes (SCs), particularly the I₁III₂IV₁ "respirasome" . This finding represents a significant advancement in understanding mitochondrial organization and function.

Mechanistically, NDUFB4 contains specific residues that interact with the subunit UQCRC1 from Complex III through hydrogen bonds . Structural analysis identified two key residues in NDUFB4:

  • Asn24 (N24)

  • Arg30 (R30)

These amino acids interact with a highly conserved loop (Y257-T266) in UQCRC1, stabilizing the interaction between Complex I and Complex III .

To validate the functional significance of these residues, researchers introduced point mutations (N24A and R30A) and observed:

ParameterNDUFB4-KOWild-type RescueN24A/R30A Mutant
Respirasome assemblyAbolishedFully restoredPartially impaired
Basal respirationSeverely reducedNormal31% reduction
Maximal respirationSeverely reducedNormal40% reduction
ATP-linked respirationSeverely reducedNormal33% reduction
Metabolic flexibilitySeverely reducedNormalReduced

These findings clearly demonstrate that NDUFB4 is integral for respirasome formation and highlight the functional significance of supercomplexes in regulating mammalian cell bioenergetics .

How do point mutations in NDUFB4 affect mitochondrial respiratory function?

Point mutations in key residues of NDUFB4 have profound effects on mitochondrial function, providing insights into structure-function relationships :

  • Effects on Supercomplex Assembly:

    • Blue-native PAGE analysis revealed that N24A and R30A mutations in NDUFB4 resulted in reduced levels of respiratory supercomplexes compared to wild-type rescue cells

    • The hierarchy of supercomplex levels was: Wild-type rescue > N24A/R30A mutant > NDUFB4-KO

    • Total Complex I levels (measured using Triton X-100 solubilization) were similar between wild-type and mutant rescue cells, indicating that the mutations specifically affect supercomplex formation rather than Complex I assembly

  • Impact on Cellular Bioenergetics:

    • Seahorse XF analysis showed significantly reduced respiratory parameters in mutant cells:

      • 31% reduction in basal oxygen consumption

      • 24% reduction in oligomycin-induced leak respiration

      • 40% reduction in maximal respiratory capacity

      • 33% reduction in ATP-linked respiration

  • Pathway-Specific Effects:

    • Complex I-specific oxidative phosphorylation was impaired in mutant cells

    • Complex II-specific oxidative phosphorylation was increased, suggesting a compensatory shift

    • Analysis of pathway utilization revealed a shift from the N-pathway (CI-linked) to the S-pathway (CII-linked)

  • Metabolic Adaptations:

    • Steady-state metabolomics revealed a global decrease in citric acid cycle metabolites

    • While NDUFB4-KO cells derived ~99% of ATP from glycolysis, the N24A/R30A mutant cells showed a ~12% higher glycolytic index compared to wild-type rescue cells

    • Both mutant and knockout cells displayed reduced metabolic flexibility

These findings demonstrate that specific amino acid residues in NDUFB4 are critical for proper respiratory function through their role in supercomplex formation, with mutations leading to significant bioenergetic reprogramming .

How does NDUFB4 in Pongo abelii compare to human NDUFB4?

While the search results don't provide a direct comprehensive comparison between Pongo abelii and human NDUFB4, several insights can be inferred:

  • Sequence Conservation: As great apes, orangutans (Pongo abelii) and humans share significant genetic similarity. The NDUFB4 protein is likely highly conserved between these species due to its crucial role in mitochondrial function and supercomplex formation.

  • Functional Conservation: NDUFB4's role in respiratory supercomplex formation appears to be conserved across mammals. Studies demonstrating NDUFB4's importance in human cell lines suggest that its function is likely similar in Pongo abelii.

  • Evolutionary Context: Research mentioned in source titled "Adaptive selection of mitochondrial complex I subunits during primate radiation" suggests that some Complex I subunits may have undergone adaptive changes during primate evolution, potentially affecting NDUFB4.

  • Population Genetics: Sumatran orangutans (Pongo abelii) show pronounced population structure caused by geographical barriers , which may have influenced genetic variation in nuclear-encoded mitochondrial proteins like NDUFB4 differently than in human populations.

Methodologically, a comprehensive comparison would require:

  • Full sequence alignment analysis

  • Structural modeling of both proteins

  • Functional complementation studies

  • Analysis of selection patterns in both lineages

What evolutionary patterns can be observed in NDUFB4 across primate species?

The evolutionary history of NDUFB4 reflects both conservation of critical function and potential adaptive changes across primates:

  • Structural Conservation: The two-domain structure of NDUFB4 is highly conserved across species , indicating strong purifying selection on this architectural feature. This conservation suggests that the fundamental role of NDUFB4 in anchoring Complex I and facilitating supercomplex formation has been maintained throughout primate evolution.

  • Potential Adaptive Selection: The study mentioned in source suggests that some Complex I subunits have undergone adaptive selection during primate radiation. This raises the possibility that certain regions of NDUFB4, particularly those not directly involved in core functions, may have experienced positive selection.

  • Coevolution Patterns: Given NDUFB4's interaction with both nuclear-encoded Complex I subunits and mitochondrial-encoded proteins (indirectly through supercomplex formation), it likely exhibits patterns of coevolution with its interaction partners. Research in source notes the "lack of apparent co-regulation between RC subunits encoded in the nuclear and mitochondrial genomes," suggesting complex evolutionary dynamics.

  • Population-Level Variation: In Pongo abelii specifically, population structure analysis has revealed "pronounced population structure, caused by major rivers, mountain ridges, and the Toba caldera" . This geographic isolation may have facilitated population-specific variation in nuclear genes like NDUFB4.

  • Methodological Approaches: Advanced evolutionary analyses would employ models described in source , including those that "allow for both synonymous and nonsynonymous rates to vary independently according to discretized gamma distributions" to detect selection signatures.

For a comprehensive evolutionary analysis, researchers should combine comparative genomics, population genetics, and molecular evolution approaches to understand how NDUFB4 has evolved while maintaining its critical function in mitochondrial respiration.

What are the implications of NDUFB4 dysfunction in mitochondrial diseases?

NDUFB4 dysfunction has significant implications for mitochondrial diseases, particularly those involving respiratory chain deficiencies:

  • Bioenergetic Deficits: Research demonstrates that alterations in NDUFB4 impair respirasome assembly and reduce mitochondrial respiratory flux , leading to decreased ATP production through oxidative phosphorylation. Such energy deficiency is a hallmark of many mitochondrial disorders.

  • Metabolic Disturbances: NDUFB4 mutations lead to a global decrease in citric acid cycle metabolites and affect NADH-generating substrates . These metabolic alterations may contribute to the complex pathophysiology observed in mitochondrial diseases.

  • Relevance to Neurodegeneration: Source notes that understanding respiratory supercomplex formation provides insights into "neurodegeneration and metabolic syndromes." Given NDUFB4's critical role in this process, its dysfunction may contribute to neurodegenerative conditions.

  • Diagnostic Implications: Analysis of NDUFB4 expression, structure, or function could potentially serve as a biomarker for certain mitochondrial disorders, particularly those affecting Complex I or supercomplex assembly.

  • Therapeutic Target Potential: NDUFB4's role in supercomplex formation suggests it could be a viable target for therapeutic interventions aimed at enhancing mitochondrial function in diseases characterized by impaired respiratory chain function.

Research in source notes that "aging and AD [Alzheimer's Disease] are associated with lower complex I and IV enzymatic activities," suggesting that NDUFB4 dysfunction could be relevant to age-related neurodegenerative diseases.

How should researchers approach studying the co-regulation of NDUFB4 with other mitochondrial proteins?

Based on methodologies used in recent research , a comprehensive approach to studying NDUFB4 co-regulation should include:

  • Untargeted Proteomics: Implement mass spectrometry-based proteomics to quantify absolute or relative protein abundances across multiple samples. This allows for assessment of co-regulation patterns among mitochondrial proteins, including NDUFB4.

  • Covariance Analysis: Analyze the correlation coefficients between NDUFB4 and other proteins to identify:

    • Co-regulation within Complex I subunits

    • Differential co-regulation based on topological location

    • Co-regulation between NDUFB4 and subunits of other complexes

    • Mito-nuclear crosstalk (correlation between nuclear-encoded NDUFB4 and mtDNA-encoded proteins)

  • Integration with Structural Information: As demonstrated in source , incorporate known biological and topological information about Complex I to inform interpretation of protein co-regulation patterns. For example:

    • Compare co-regulation of NDUFB4 with proteins in the same module (P_D) versus different modules

    • Assess co-regulation with proteins that physically interact with NDUFB4

  • Multi-tissue Comparison: Analyze co-regulation patterns across different tissues to identify tissue-specific regulatory mechanisms.

  • Experimental Validation: Use techniques like CRISPR-mediated gene editing to modulate NDUFB4 expression and observe effects on other proteins.

Research in source found that within Complex I, matrix-located subunits showed 24% higher co-regulation than membrane subunits, and proteins in the N module (r=0.68) showed greater co-regulation than those in the Q (r=0.50) or P module (r=0.49). Such topological sensitivity in co-regulation patterns provides insights into the relative stability or coordinated turnover of different protein modules within Complex I.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.