Recombinant Pongo abelii NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (NDUFB4) is a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase, also known as Complex I. Complex I is responsible for transferring electrons from NADH to ubiquinone in the respiratory chain . NDUFB4 is considered an accessory subunit, meaning it is not directly involved in the catalytic activity of Complex I .
Recombinant full-length Pongo abelii NDUFB4 protein is expressed in E. coli with an N-terminal His tag .
Source: E. coli
Tag: His-tagged
Protein Length: Full Length of Mature Protein (2-129aa)
Form: Lyophilized powder
Purity: Greater than 90% as determined by SDS-PAGE
Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
The amino acid sequence is:
SFPKYKPSRLSPLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIE NPALLRWAYARTTNVYPNFRPTPKNSLMGALYGFGPLIFIYYIIKTERDRKEKLIQEGKL DRTFHLSY
NDUFB4 is an accessory subunit of Complex I, which functions in the transfer of electrons from NADH to the respiratory chain, using ubiquinone as the electron acceptor . Although NDUFB4 is not thought to be directly involved in catalysis, it is essential for the proper function and assembly of Complex I .
NDUFB4 interacts with other subunits of Complex I, including NDUFA11, NDUFS3, NDUFA2, NDUFS6, NDUFS4, NDUFB9, NDUFA6, NDUFA5, NDUFB8, and NDUFB3 .
While NDUFS4 is the most studied Complex I subunit in the context of mitochondrial diseases, research indicates that NDUFB4 expression does not change consistently in conditions such as diabetic kidney disease (DKD) . This suggests that NDUFB4 may not play as central a role in the pathogenesis of DKD as other subunits like NDUFS4 . NDUFS4 regulates cristae remodeling in diabetic kidney disease .
STRING: 9601.ENSPPYP00000015101
NDUFB4 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4) is an accessory subunit of Complex I (NADH dehydrogenase) within the mitochondrial respiratory chain. While this 15 kDa protein composed of 129 amino acids was initially believed not to be directly involved in the catalytic function of transferring electrons from NADH to ubiquinone, recent research has revealed its critical role in respiratory supercomplex formation .
The structure of NDUFB4 is characterized by an N-terminal hydrophobic domain that folds into an alpha helix spanning the inner mitochondrial membrane, with a C-terminal hydrophilic domain that interacts with globular subunits of Complex I . This two-domain structure is highly conserved, suggesting its fundamental importance for protein function.
Research methodology for studying NDUFB4 function includes:
Blue-native PAGE (BN-PAGE) to analyze native protein complexes
Point mutation analysis of specific residues (particularly N24 and R30)
Respirometry assays to measure oxygen consumption
Metabolomic analysis to assess downstream effects
NDUFB4 is one of approximately 31 hydrophobic subunits forming the transmembrane region of Complex I . Complex I has an L-shaped structure consisting of:
A hydrophobic membrane arm embedded in the inner mitochondrial membrane
A hydrophilic matrix arm protruding into the mitochondrial matrix
NDUFB4 is specifically located in the membrane arm of Complex I, within the P_D (distal) module . This positioning is strategically important as it enables NDUFB4 to interact with subunits from Complex III, particularly UQCRC1, facilitating the formation of respiratory supercomplexes .
| Complex I Module | Location | Co-regulation Level | Function |
|---|---|---|---|
| N module | Matrix arm | High (r=0.68) | NADH binding |
| Q module | Junction | Medium (r=0.50) | Ubiquinone binding |
| P module (includes NDUFB4) | Membrane arm | Medium (r=0.49) | Proton pumping |
The highly conserved two-domain structure of NDUFB4 suggests that this feature is critical for anchoring the NADH dehydrogenase complex at the inner mitochondrial membrane .
Multiple methodological approaches are employed in studying recombinant Pongo abelii NDUFB4:
Protein Expression and Purification: Commercial recombinant protein production typically utilizes bacterial or yeast expression systems with subsequent purification using affinity chromatography . For example, the recombinant NDUFB4 protein from Pongo abelii described in source is supplied in a Tris-based buffer with 50% glycerol and recommended storage at -20°C.
Functional Assays: To assess NDUFB4 function, researchers employ:
Structural Studies: Techniques like cryo-electron microscopy help resolve molecular interactions between NDUFB4 and other complex subunits.
Evolutionary Analysis: Methods described in source employ statistical models of codon evolution allowing for independent variation of synonymous and nonsynonymous rates to study protein evolution across species.
Based on methodologies employed in recent research , a comprehensive experimental approach should include:
Generate Cellular Models:
Create NDUFB4 knockout cell lines using CRISPR/Cas9
Establish rescue cell lines with:
Wild-type NDUFB4 (positive control)
Point mutations at key residues (N24A, R30A)
C-terminal FLAG tags for detection
Assess Supercomplex Assembly:
Perform blue-native PAGE of digitonin-solubilized membrane proteins
Conduct immunoblot analysis using antibodies against:
NDUFA9 (Q module subunit)
NDUFB10 (P_D module subunit)
UQCRC1 (Complex III subunit)
Evaluate Respiratory Function:
Measure oxygen consumption rates (OCR) using Seahorse XF analyzer
Assess basal, leak, maximal, and ATP-linked respiration
Evaluate pathway-specific respiration by stimulating:
Complex I-specific OXPHOS (N-pathway)
Complex II-specific OXPHOS (S-pathway)
Combined CI+CII-linked OXPHOS
Analyze Metabolic Consequences:
Perform steady-state metabolomics to assess citric acid cycle intermediates
Measure activities of key metabolic enzymes (citrate synthase, malate dehydrogenase)
Determine glycolytic flux and metabolic flexibility
This integrated approach allows for comprehensive characterization of NDUFB4's role in supercomplex formation and its impact on cellular bioenergetics.
Recent research has revealed that NDUFB4 is critical for the assembly and stability of respiratory supercomplexes (SCs), particularly the I₁III₂IV₁ "respirasome" . This finding represents a significant advancement in understanding mitochondrial organization and function.
Mechanistically, NDUFB4 contains specific residues that interact with the subunit UQCRC1 from Complex III through hydrogen bonds . Structural analysis identified two key residues in NDUFB4:
Asn24 (N24)
Arg30 (R30)
These amino acids interact with a highly conserved loop (Y257-T266) in UQCRC1, stabilizing the interaction between Complex I and Complex III .
To validate the functional significance of these residues, researchers introduced point mutations (N24A and R30A) and observed:
| Parameter | NDUFB4-KO | Wild-type Rescue | N24A/R30A Mutant |
|---|---|---|---|
| Respirasome assembly | Abolished | Fully restored | Partially impaired |
| Basal respiration | Severely reduced | Normal | 31% reduction |
| Maximal respiration | Severely reduced | Normal | 40% reduction |
| ATP-linked respiration | Severely reduced | Normal | 33% reduction |
| Metabolic flexibility | Severely reduced | Normal | Reduced |
These findings clearly demonstrate that NDUFB4 is integral for respirasome formation and highlight the functional significance of supercomplexes in regulating mammalian cell bioenergetics .
Point mutations in key residues of NDUFB4 have profound effects on mitochondrial function, providing insights into structure-function relationships :
Effects on Supercomplex Assembly:
Blue-native PAGE analysis revealed that N24A and R30A mutations in NDUFB4 resulted in reduced levels of respiratory supercomplexes compared to wild-type rescue cells
The hierarchy of supercomplex levels was: Wild-type rescue > N24A/R30A mutant > NDUFB4-KO
Total Complex I levels (measured using Triton X-100 solubilization) were similar between wild-type and mutant rescue cells, indicating that the mutations specifically affect supercomplex formation rather than Complex I assembly
Impact on Cellular Bioenergetics:
Seahorse XF analysis showed significantly reduced respiratory parameters in mutant cells:
31% reduction in basal oxygen consumption
24% reduction in oligomycin-induced leak respiration
40% reduction in maximal respiratory capacity
33% reduction in ATP-linked respiration
Pathway-Specific Effects:
Complex I-specific oxidative phosphorylation was impaired in mutant cells
Complex II-specific oxidative phosphorylation was increased, suggesting a compensatory shift
Analysis of pathway utilization revealed a shift from the N-pathway (CI-linked) to the S-pathway (CII-linked)
Metabolic Adaptations:
Steady-state metabolomics revealed a global decrease in citric acid cycle metabolites
While NDUFB4-KO cells derived ~99% of ATP from glycolysis, the N24A/R30A mutant cells showed a ~12% higher glycolytic index compared to wild-type rescue cells
Both mutant and knockout cells displayed reduced metabolic flexibility
These findings demonstrate that specific amino acid residues in NDUFB4 are critical for proper respiratory function through their role in supercomplex formation, with mutations leading to significant bioenergetic reprogramming .
While the search results don't provide a direct comprehensive comparison between Pongo abelii and human NDUFB4, several insights can be inferred:
Sequence Conservation: As great apes, orangutans (Pongo abelii) and humans share significant genetic similarity. The NDUFB4 protein is likely highly conserved between these species due to its crucial role in mitochondrial function and supercomplex formation.
Functional Conservation: NDUFB4's role in respiratory supercomplex formation appears to be conserved across mammals. Studies demonstrating NDUFB4's importance in human cell lines suggest that its function is likely similar in Pongo abelii.
Evolutionary Context: Research mentioned in source titled "Adaptive selection of mitochondrial complex I subunits during primate radiation" suggests that some Complex I subunits may have undergone adaptive changes during primate evolution, potentially affecting NDUFB4.
Population Genetics: Sumatran orangutans (Pongo abelii) show pronounced population structure caused by geographical barriers , which may have influenced genetic variation in nuclear-encoded mitochondrial proteins like NDUFB4 differently than in human populations.
Methodologically, a comprehensive comparison would require:
Full sequence alignment analysis
Structural modeling of both proteins
Functional complementation studies
Analysis of selection patterns in both lineages
The evolutionary history of NDUFB4 reflects both conservation of critical function and potential adaptive changes across primates:
Structural Conservation: The two-domain structure of NDUFB4 is highly conserved across species , indicating strong purifying selection on this architectural feature. This conservation suggests that the fundamental role of NDUFB4 in anchoring Complex I and facilitating supercomplex formation has been maintained throughout primate evolution.
Potential Adaptive Selection: The study mentioned in source suggests that some Complex I subunits have undergone adaptive selection during primate radiation. This raises the possibility that certain regions of NDUFB4, particularly those not directly involved in core functions, may have experienced positive selection.
Coevolution Patterns: Given NDUFB4's interaction with both nuclear-encoded Complex I subunits and mitochondrial-encoded proteins (indirectly through supercomplex formation), it likely exhibits patterns of coevolution with its interaction partners. Research in source notes the "lack of apparent co-regulation between RC subunits encoded in the nuclear and mitochondrial genomes," suggesting complex evolutionary dynamics.
Population-Level Variation: In Pongo abelii specifically, population structure analysis has revealed "pronounced population structure, caused by major rivers, mountain ridges, and the Toba caldera" . This geographic isolation may have facilitated population-specific variation in nuclear genes like NDUFB4.
Methodological Approaches: Advanced evolutionary analyses would employ models described in source , including those that "allow for both synonymous and nonsynonymous rates to vary independently according to discretized gamma distributions" to detect selection signatures.
For a comprehensive evolutionary analysis, researchers should combine comparative genomics, population genetics, and molecular evolution approaches to understand how NDUFB4 has evolved while maintaining its critical function in mitochondrial respiration.
NDUFB4 dysfunction has significant implications for mitochondrial diseases, particularly those involving respiratory chain deficiencies:
Bioenergetic Deficits: Research demonstrates that alterations in NDUFB4 impair respirasome assembly and reduce mitochondrial respiratory flux , leading to decreased ATP production through oxidative phosphorylation. Such energy deficiency is a hallmark of many mitochondrial disorders.
Metabolic Disturbances: NDUFB4 mutations lead to a global decrease in citric acid cycle metabolites and affect NADH-generating substrates . These metabolic alterations may contribute to the complex pathophysiology observed in mitochondrial diseases.
Relevance to Neurodegeneration: Source notes that understanding respiratory supercomplex formation provides insights into "neurodegeneration and metabolic syndromes." Given NDUFB4's critical role in this process, its dysfunction may contribute to neurodegenerative conditions.
Diagnostic Implications: Analysis of NDUFB4 expression, structure, or function could potentially serve as a biomarker for certain mitochondrial disorders, particularly those affecting Complex I or supercomplex assembly.
Therapeutic Target Potential: NDUFB4's role in supercomplex formation suggests it could be a viable target for therapeutic interventions aimed at enhancing mitochondrial function in diseases characterized by impaired respiratory chain function.
Research in source notes that "aging and AD [Alzheimer's Disease] are associated with lower complex I and IV enzymatic activities," suggesting that NDUFB4 dysfunction could be relevant to age-related neurodegenerative diseases.
Based on methodologies used in recent research , a comprehensive approach to studying NDUFB4 co-regulation should include:
Untargeted Proteomics: Implement mass spectrometry-based proteomics to quantify absolute or relative protein abundances across multiple samples. This allows for assessment of co-regulation patterns among mitochondrial proteins, including NDUFB4.
Covariance Analysis: Analyze the correlation coefficients between NDUFB4 and other proteins to identify:
Co-regulation within Complex I subunits
Differential co-regulation based on topological location
Co-regulation between NDUFB4 and subunits of other complexes
Mito-nuclear crosstalk (correlation between nuclear-encoded NDUFB4 and mtDNA-encoded proteins)
Integration with Structural Information: As demonstrated in source , incorporate known biological and topological information about Complex I to inform interpretation of protein co-regulation patterns. For example:
Compare co-regulation of NDUFB4 with proteins in the same module (P_D) versus different modules
Assess co-regulation with proteins that physically interact with NDUFB4
Multi-tissue Comparison: Analyze co-regulation patterns across different tissues to identify tissue-specific regulatory mechanisms.
Experimental Validation: Use techniques like CRISPR-mediated gene editing to modulate NDUFB4 expression and observe effects on other proteins.
Research in source found that within Complex I, matrix-located subunits showed 24% higher co-regulation than membrane subunits, and proteins in the N module (r=0.68) showed greater co-regulation than those in the Q (r=0.50) or P module (r=0.49). Such topological sensitivity in co-regulation patterns provides insights into the relative stability or coordinated turnover of different protein modules within Complex I.