Recombinant Pongo abelii NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (NDUFB6)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pongo abelii NADH Dehydrogenase [Ubiquinone] 1 Beta Subcomplex Subunit 6 (NDUFB6)

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6, also known as complex I-B17, is a protein that in humans is encoded by the NDUFB6 gene . It is an accessory subunit of the NADH dehydrogenase (ubiquinone) complex, also known as Complex I, which is located in the mitochondrial inner membrane . Complex I is the largest of the five complexes of the electron transport chain . NDUFB6 is believed not to be directly involved in catalysis but is required for electron transfer activity .

Gene and Structure

The NDUFB6 gene is located on the p arm of chromosome 9 in position 21.1 and is 19,659 base pairs long . The NDUFB6 protein weighs 15.5 kDa and is composed of 128 amino acids . The structure is L-shaped, featuring a long, hydrophobic transmembrane domain and a hydrophilic domain for the peripheral arm, which includes all the known redox centers and the NADH binding site . The N-terminal hydrophobic domain has the potential to be folded into an alpha helix spanning the inner mitochondrial membrane, with a C-terminal hydrophilic domain interacting with globular subunits of Complex I . This two-domain structure is highly conserved, suggesting it is critical for protein function, with the hydrophobic domain acting as an anchor for the NADH dehydrogenase (ubiquinone) complex at the inner mitochondrial membrane .

Function of NDUFB6

The protein encoded by the NDUFB6 gene is an accessory subunit of the multisubunit NADH: ubiquinone oxidoreductase (complex I) that is not directly involved in catalysis . Mammalian complex I comprises 44 different subunits and is located in the mitochondrial inner membrane . This protein complex exhibits both NADH dehydrogenase activity and oxidoreductase activity, transferring electrons from NADH to the respiratory chain . The immediate electron acceptor for the enzyme is believed to be ubiquinone .

Initially, NADH binds to Complex I and transfers two electrons to the isoalloxazine ring of the flavin mononucleotide (FMN) prosthetic arm to form FMNH$$_2$$ . The electrons are then transferred through a series of iron-sulfur (Fe-S) clusters in the prosthetic arm and finally to coenzyme Q10 (CoQ), which is reduced to ubiquinol (CoQH$$_2$$) . The flow of electrons alters the redox state of the protein, resulting in a conformational change and a shift in the pK of the ionizable side chain, which pumps four hydrogen ions out of the mitochondrial matrix .

Clinical Significance

Decreased expression of genes involved in oxidative phosphorylation, including NDUFB6, is associated with insulin resistance and type 2 diabetes . A polymorphism in the promoter region of the NDUFB6 gene, resulting in an adenine to guanine shift at rs629566, has been shown to create a DNA methylation site associated with a decline in NDUFB6 expression in the muscle of aging patients .

NDUFB6 Antibody

NDUFB6 is a 128 amino acid protein that belongs to the complex I NDUFB6 subunit family . It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed not to be involved in catalysis . Complex I functions in the transfer of electrons from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor .

Table 1: Antibody Information

AttributeDescription
TargetNDUFB6
Tested ReactivityHuman, mouse, rat
Cited ReactivityHuman, mouse
Host / IsotypeRabbit / IgG
ClassPolyclonal
ApplicationWB, IHC, ELISA
ImmunogenNDUFB6 fusion protein Ag8908
Full NameNADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa
Calculated Molecular Weight128 aa, 15 kDa
Observed Molecular Weight16-20 kDa
GenBank Accession NumberBC009801
Gene SymbolNDUFB6
Gene ID (NCBI)4712
RRIDAB_2235901
Purification MethodAntigen affinity purification
UNIPROT IDO95139
Storage BufferPBS with 0.02% sodium azide and 50% glycerol pH 7.3

Table 2: Application Details

ApplicationPositive Detection InRecommended Dilution
Western Blot (WB)A549 cells, LNCaP cells, MCF-7 cells, mouse skeletal muscle tissue, rat skeletal muscle tissue1:1000-1:4000
ImmunohistochemistryHuman liver cancer tissue (suggested antigen retrieval with TE buffer pH 9.0 or citrate buffer pH 6.0 alternatively)1:50-1:500

Expression

NDUFB6 exhibits a wide range of expression across various tissues, including the brain (hippocampal formation, amygdala, basal ganglia, midbrain, spinal cord, cerebral cortex, cerebellum, hypothalamus, choroid plexus, retina), thyroid gland, parathyroid gland, adrenal gland, pituitary gland, lung, salivary gland, esophagus, tongue, stomach, rectum, colon, small intestine, duodenum, liver, gallbladder, pancreas, kidney, urinary bladder, testis, epididymis, prostate, seminal vesicle, vagina, breast, cervix, endometrium, fallopian tube, ovary, placenta, heart muscle, skeletal muscle, smooth muscle, adipose tissue, skin, bone marrow, tonsil, lymph node, thymus, and spleen .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NDUFB6; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; Complex I-B17; CI-B17; NADH-ubiquinone oxidoreductase B17 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-128
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
TEYTPDEKLRLHQLRKLRRRWLKDQELSHREPVLPPQKMGPMEKFWNTFLENKSPWRKMV HGVYQKSIFVFTHILVPAWIIHYYMKYHVSEKPYGIVETKPRIFPGDTILETGEVIPPMK EFPDQHH
Uniprot No.

Target Background

Function

NDUFB6 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is not believed to be directly involved in catalysis. Complex I facilitates the transfer of electrons from NADH to the respiratory chain, with ubiquinone considered the immediate electron acceptor.

Database Links
Protein Families
Complex I NDUFB6 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.