Recombinant Pongo abelii NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial (NDUFB8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
NDUFB8; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial; Complex I-ASHI; CI-ASHI; NADH-ubiquinone oxidoreductase ASHI subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-186
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
ASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDP WYSWDQPDLRLNWGEPMHWHLDMFNRNRVDTSPILVSWNVMCMQLFGFLAFMIFMCWVGE VYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
Uniprot No.

Target Background

Function

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), not believed to be directly involved in catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone considered the immediate electron acceptor.

Database Links
Protein Families
Complex I NDUFB8 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

What is the genomic characterization of the NDUFB8 gene in Pongo abelii?

NDUFB8 in Pongo abelii (Sumatran orangutan) is a protein-coding gene with Entrez Gene ID 100174138. The gene encodes NADH:ubiquinone oxidoreductase subunit B8, a critical component of the mitochondrial electron transport chain. Based on reference sequence data, the mRNA sequence is represented by accession NM_001133629.1, which encodes the protein product NP_001127101.1, identified as "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial precursor" . The coding sequence has a length of 561 base pairs. When conducting genomic analysis of this gene, researchers should note that the reference sequence is provisional and was derived from CR926037.1, with evidence for transcript exon combination from the same source .

Methodologically, when analyzing orthologous sequences across species, researchers should be aware that while NDUFB8 is highly conserved among vertebrates, conservation decreases significantly in insects and other animals, and is rather poor in fungi and plants . This conservation pattern should be considered when designing cross-species experiments or performing evolutionary analyses.

How does the structural organization of NDUFB8 protein relate to its function?

The NDUFB8 protein exhibits a characteristic two-domain structure that is critical for its function within the mitochondrial respiratory chain. The protein has a molecular weight of approximately 22 kDa and consists of 186 amino acids . The protein's structure is L-shaped with a distinctive organization:

  • N-terminal hydrophobic domain: Capable of folding into an alpha helix that spans the inner mitochondrial membrane

  • C-terminal hydrophilic domain: Interacts with the globular subunits of Complex I

This two-domain structure is highly conserved, indicating its functional importance. The hydrophobic domain serves as an anchor for the NADH dehydrogenase complex at the inner mitochondrial membrane . When designing experiments to study NDUFB8 localization, researchers should utilize techniques that can distinguish between intermembrane space proteins and matrix-facing proteins, as NDUFB8 and NDUFB7 have been shown to localize at the intermembrane surface of complex I .

For structural studies, it's important to note that recent cryo-electron microscopy (cryo-EM) at 4.0-Å resolution of porcine heart supercomplex CI₁III₂IV₁ revealed that NDUFB8 directly contributes to the oligomerization of complexes I, III, and IV . This finding suggests that NDUFB8 plays a crucial role not just in complex I function but also in the organization of respiratory supercomplexes.

What are the optimal methods for expressing recombinant Pongo abelii NDUFB8 in experimental systems?

When expressing recombinant Pongo abelii NDUFB8, researchers should consider the following methodological approach based on established protocols:

The NDUFB8 gene cDNA ORF clone can be obtained from standard vectors such as pcDNA3.1+/C-(K)DYK or customized vectors for expression studies . The recommended expression methodology includes:

  • Vector selection: The standard pcDNA3.1+/C-(K)DYK vector includes C-terminal DYKDDDDK tags, facilitating protein detection and purification .

  • Cloning method: CloneEZ™ Seamless cloning technology has been successfully employed for NDUFB8 insertion into expression vectors with a linear insert structure .

  • Expression system: For functional studies, mammalian expression systems are preferred due to the requirement for proper mitochondrial targeting and post-translational modifications.

  • Verification of expression: Western blot analysis using antibodies against NDUFB8 is an effective method to confirm successful expression .

For complementation studies, as demonstrated in previous research, expression of wild-type NDUFB8 in cells from affected individuals with NDUFB8 mutations restored mitochondrial function . This approach confirmed NDUFB8 variants as the cause of complex I deficiency and established a reliable experimental paradigm for functional rescue experiments.

How can researchers effectively measure NDUFB8 activity and its impact on mitochondrial respiration?

To measure NDUFB8 activity and its impact on mitochondrial respiration, researchers should employ a multi-faceted approach combining biochemical and functional assays:

  • Complex I enzymatic activity: Isolated decrease in complex I enzymatic activity can be measured in muscle tissue and fibroblast samples. This is a key indicator of NDUFB8 dysfunction .

  • Microscale respirometry (Seahorse): This technique provides quantitative measurement of basal and maximal respiration in fibroblasts. In cells with NDUFB8 deficiency, decreased respiratory capacity has been observed, which returns to normal activity after expression of wild-type NDUFB8 . When designing these experiments, include appropriate controls and consider the following parameters:

    • Basal respiration

    • Maximal respiration (after uncoupler addition)

    • ATP production capacity

    • Spare respiratory capacity

  • Western blot analysis: Can be performed on either:

    • SDS polyacrylamide electrophoresis with antibodies against NDUFS4 and NDUFB8

    • Blue native gel electrophoresis to assess the integrity of complex I and supercomplex formation

  • Complementation studies: Expression of wild-type NDUFB8 in cells from affected individuals can be used to confirm causality of NDUFB8 variants in observed phenotypes .

The combined results from these methodological approaches provide comprehensive insights into NDUFB8 function and its critical role in mitochondrial complex I activity.

What role does NDUFB8 play in the assembly and stability of mitochondrial complex I?

NDUFB8 serves as an accessory subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I) and plays a critical role in complex stability rather than direct catalytic activity . Based on structural and functional analyses, NDUFB8's contribution to complex I can be characterized as follows:

  • Structural organization: NDUFB8 (bovine ortholog: ASHI) is one of the accessory subunits that encircles the core of complex I and is bound to ND5 in the proton pumping module . This positioning is crucial for maintaining the structural integrity of the complex.

  • Membrane anchoring: The N-terminal hydrophobic domain of NDUFB8 acts as an anchor for the NADH dehydrogenase complex at the inner mitochondrial membrane, while the C-terminal hydrophilic domain interacts with globular subunits of Complex I .

  • Supercomplex formation: Recent cryo-EM structures at 4.0-Å resolution have revealed that NDUFB8 directly contributes to the oligomerization of complexes I, III, and IV (CI₁III₂IV₁ supercomplex) . This finding suggests that NDUFB8 is not only important for complex I stability but also for the organization of respiratory supercomplexes.

When investigating complex I assembly, researchers should note that mammalian complex I consists of 45 different subunits . Therefore, interaction studies should account for multiple potential binding partners and assembly intermediates.

How do mutations in NDUFB8 affect the structure and function of mitochondrial complex I?

Mutations in NDUFB8 have profound effects on the structure and function of mitochondrial complex I, as evidenced by biochemical and clinical investigations. When studying these effects, researchers should examine:

  • Complex I assembly: Biallelic variants in NDUFB8 lead to isolated decrease in complex I enzymatic activity in muscle and fibroblasts . This suggests that mutations disrupt either the assembly or stability of the complex.

  • Respiratory capacity: NDUFB8 mutations result in decreased basal and maximal respiration in fibroblasts, as measured by microscale respirometry . These functional deficits are directly attributable to NDUFB8 dysfunction, as evidenced by restoration of normal activity after expression of wild-type NDUFB8.

  • Protein stability: Western blot analysis on SDS polyacrylamide electrophoresis with antibodies against NDUFS4 and NDUFB8 and on blue native gel electrophoresis demonstrates that the amount of complex I protein normalizes after NDUFB8 transduction . This indicates that mutations may affect either protein stability or complex assembly.

  • Supercomplex formation: Given NDUFB8's role in the oligomerization of CI, CIII, and CIV, mutations likely disrupt supercomplex formation, potentially explaining the severe cellular consequences observed in affected individuals .

When designing experiments to study NDUFB8 mutations, researchers should consider complementation studies as a gold standard for confirming causality. Expression of wild-type NDUFB8 in cells from affected individuals has been shown to restore mitochondrial function, confirming NDUFB8 variants as the cause of complex I deficiency .

What is the clinical presentation of NDUFB8 mutations and how does it relate to mitochondrial complex I deficiency?

NDUFB8 mutations have been established as a cause of mitochondrial complex I deficiency with distinct clinical manifestations. Patients with biallelic variants in NDUFB8 present with a progressive course of disease characterized by:

  • Encephalo(cardio)myopathic features including:

    • Muscular hypotonia

    • Cardiac hypertrophy

    • Respiratory failure

    • Failure to thrive

    • Developmental delay

  • Biochemical abnormalities:

    • Elevated blood lactate

    • Isolated decrease in complex I enzymatic activity in muscle and fibroblasts

  • Neuroimaging findings:

    • Progressive changes in the basal ganglia

    • Lesions in either brain stem or internal capsule

    • In some cases, progressive brain atrophy extending beyond classical Leigh syndrome lesions

How can advanced genomic analysis techniques be applied to identify novel NDUFB8 variants in mitochondrial disease patients?

For researchers investigating potential NDUFB8-related mitochondrial diseases, the following genomic analysis approach is recommended:

  • Whole-exome sequencing (WES): This has been successfully used to identify rare biallelic variants in NDUFB8 . When conducting WES:

    • Achieve high coverage (e.g., >80 million reads with 20-fold coverage >90%)

    • Apply appropriate filtering strategies for variants with minor allele frequency (MAF) <0.1% in both in-house and public databases

    • Perform bi-allelic filtering to identify potential recessive inheritance patterns

  • Variant prioritization: Focus on genes with mitochondrial localization. For example, in one case study, filtering for bi-allelic variants resulted in identification of five genes including NDUFB8 as the only one with mitochondrial localization .

  • Conservation analysis: Evaluate the conservation of orthologous sequences across species. NDUFB8 is highly conserved among vertebrates, with decreasing conservation in insects and other animals, and poor conservation in fungi and plants .

  • Functional validation: Confirm the pathogenicity of identified variants through:

    • Biochemical analyses showing isolated decrease in complex I enzymatic activity

    • Complementation studies by expression of wild-type NDUFB8 in patient cells

    • Microscale respirometry to measure restoration of basal and maximal respiration

    • Western blot analysis to confirm normalization of complex I protein levels

This comprehensive approach enables researchers to establish causality between NDUFB8 variants and observed clinical phenotypes, contributing to the expanding understanding of genetic etiologies in mitochondrial disorders.

How does Pongo abelii NDUFB8 compare structurally and functionally to its human ortholog?

Comparative analysis of Pongo abelii (Sumatran orangutan) NDUFB8 with its human ortholog reveals important insights into the conservation and evolution of this critical mitochondrial protein:

  • Sequence conservation: NDUFB8 is highly conserved among vertebrates, including between humans and orangutans . This high degree of conservation suggests functional importance and evolutionary constraints on sequence variation.

  • Structural features: Both human and Pongo abelii NDUFB8 proteins share the characteristic two-domain structure:

    • An N-terminal hydrophobic domain that spans the inner mitochondrial membrane

    • A C-terminal hydrophilic domain that interacts with other complex I subunits

  • Functional role: In both species, NDUFB8 serves as an accessory subunit of complex I, contributing to structural stability rather than direct catalytic activity .

When conducting comparative studies, researchers should note that understanding derived from bovine (ASHI) and porcine models indicates NDUFB8 encircles the core of complex I, binds to ND5 in the proton pumping module, and contributes to supercomplex formation . These structural and functional aspects are likely conserved in both human and Pongo abelii orthologs.

For experimental approaches comparing the two orthologs, complementation studies represent a valuable methodology. Expression of either ortholog in NDUFB8-deficient cells could reveal functional equivalence or subtle differences in complex I assembly and activity.

What insights can be gained from studying NDUFB8 across different primate species in the context of mitochondrial evolution?

Studying NDUFB8 across primate species provides valuable insights into mitochondrial evolution and adaptation:

When designing comparative studies across primate species, researchers should employ phylogenetic methods that account for the topology and branch lengths of the primate tree. Additionally, integration of structural data can help map sequence variations onto the three-dimensional structure of complex I to assess potential functional impacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.