Recombinant Pongo abelii NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a genetically engineered protein derived from the mitochondrial genome of the Sumatran orangutan. It encodes a subunit of Complex I (NADH dehydrogenase, ubiquinone), a critical component of the electron transport chain responsible for ATP production in mitochondria . This recombinant protein is produced via heterologous expression systems (e.g., E. coli or yeast) and is tagged for purification and functional studies .
MT-ND4L is a core subunit of Complex I, which catalyzes the transfer of electrons from NADH to ubiquinone (CoQ10) while pumping protons across the mitochondrial inner membrane . Key functions include:
Electron Transfer: Facilitates the redox reaction , critical for ATP synthesis .
Proton Pumping: Conformational changes during electron transfer drive proton translocation .
Disease Association: Mutations in human MT-ND4L (e.g., T10,663C) are linked to Leber’s Hereditary Optic Neuropathy (LHON) and metabolic disorders .
While recombinant Pongo abelii MT-ND4L is commercially available, its direct research applications remain limited compared to human orthologs. Potential uses include:
KEGG: pon:808477
STRING: 9601.ENSPPYP00000023447
Recombinant Pongo abelii MT-ND4L is a small hydrophobic protein with several distinctive structural features. The protein consists of 98 amino acids with the sequence MPLIYMNITLAFTMSLLGMLVYRSHLMSSLLCLEGMMLSLFIMITLMTLNTHSLLANIMP ITMVFAACEAAVGLALLASISNTYGLDYVNNLNLLQC . This sequence reveals a highly hydrophobic profile consistent with its role as a transmembrane protein embedded in the inner mitochondrial membrane. The protein has a molecular mass of approximately 10.74 kDa , making it one of the smaller subunits of complex I.
When produced as a recombinant protein, MT-ND4L is typically stored in a Tris-based buffer with 50% glycerol to maintain stability . Researchers should note that repeated freezing and thawing is not recommended for this protein, and working aliquots should be stored at 4°C for up to one week . The hydrophobic nature of MT-ND4L presents challenges for experimental handling, often requiring specialized techniques for solubilization and functional reconstitution.
Several complementary techniques have proven effective for detecting and studying MT-ND4L in various experimental systems:
Western Blot (WB): This technique allows for specific detection of MT-ND4L in protein extracts. Due to the small size of the protein (approximately 10.7 kDa), higher percentage gels (12-15%) are recommended for optimal resolution .
Enzyme-Linked Immunosorbent Assay (ELISA): ELISA provides quantitative measurement of MT-ND4L concentration in various sample types. Recombinant proteins can serve as standards for calibration curves in these assays .
Immunohistochemistry (IHC): This method enables visualization of MT-ND4L distribution within tissue sections, providing valuable information about its localization in different cell types and subcellular compartments .
Flow Cytometry: For cell-based studies, flow cytometry can detect MT-ND4L levels across cell populations, particularly useful when examining heterogeneous samples .
When implementing these methods, it is essential to validate antibody specificity by testing on tissues known to express MT-ND4L positively and negatively . For recombinant protein studies, tag-specific detection methods can also be employed, although the tag type may vary depending on the production process .
Measuring complex I activity in systems containing recombinant MT-ND4L requires careful consideration of both assay conditions and appropriate controls:
NADH Oxidation Assays: The primary approach involves monitoring NADH oxidation spectrophotometrically at 340-420 nm (ε = 6.22 mM⁻¹cm⁻¹) . Typical reaction conditions include 20 mM Tris-HCl (pH 7.5), 30 μM NADH, and carefully titrated amounts of the recombinant protein or reconstituted complex . Temperature control is essential, with 30°C being commonly used.
Hydrogen Peroxide Production Measurement: The Amplex Red assay provides a sensitive method for detecting H₂O₂ production, which can indicate electron leakage from complex I. Standard conditions include 10 μM Amplex Red, 0.4 unit/mL horseradish peroxidase, with monitoring at 557-620 nm (ε = 51.6 mM⁻¹cm⁻¹) .
Control Experiments: Critical controls should include:
Parallel assays with specific complex I inhibitors (e.g., rotenone)
Addition of superoxide dismutase (SOD, 10 units/mL) and catalase (CAT, 1000 units/mL) to distinguish between different reactive oxygen species
Redox titrations varying the NAD⁺/NADH ratio to assess activity under different redox states
Data Normalization: Activities should be normalized to protein concentration or more specifically to complex I content, often determined by FMN concentration measured fluorometrically .
These approaches collectively provide a comprehensive assessment of recombinant MT-ND4L functionality within complex I, addressing both normal electron transport activity and potential aberrant ROS production.
Maintaining the stability and functionality of recombinant Pongo abelii MT-ND4L requires specific storage and handling protocols:
Adherence to these handling protocols is particularly important for membrane proteins like MT-ND4L, which are inherently unstable when removed from their native lipid environment.
Modeling MT-ND4L mutations associated with diseases requires a multi-tiered approach that spans from molecular to cellular systems:
This multi-level modeling approach allows researchers to connect molecular defects to cellular pathology and ultimately to clinical presentations, providing insights into both disease mechanisms and potential therapeutic interventions.
MT-ND4L plays a significant role in the pathophysiology of Leber hereditary optic neuropathy (LHON) through several interconnected mechanisms:
Mutation Characteristics: A specific mutation in the MT-ND4L gene, identified as T10663C or Val65Ala, has been documented in several families with LHON . This mutation replaces the amino acid valine with alanine at position 65 of the NADH dehydrogenase 4L protein, affecting a highly conserved region essential for function .
Bioenergetic Compromise: The mutation likely disrupts electron transport through complex I, reducing the efficiency of ATP production through oxidative phosphorylation . This energy deficiency is particularly problematic in retinal ganglion cells, which have high metabolic demands and limited capacity for compensatory mechanisms.
Oxidative Stress: Dysfunctional complex I contributes to increased production of reactive oxygen species (ROS) . These free radicals can damage cellular components, including mitochondrial DNA, proteins, and lipids, creating a vicious cycle of mitochondrial dysfunction.
Unique Gender Bias: Interestingly, while LHON typically shows male predominance with other mutations, some families with MT-ND4L mutations show a distinctive pattern where primarily female matrilineal relatives are affected . This suggests complex gender-specific modifier effects that remain poorly understood.
Haplogroup Influence: The phenotypic expression of MT-ND4L mutations appears to be influenced by the mitochondrial genetic background, with specific mtDNA haplotypes potentially exacerbating or ameliorating the primary mutation's effects .
Understanding these pathophysiological mechanisms provides insights for developing therapeutic approaches targeting energy production enhancement, ROS reduction, and neuroprotection in LHON patients with MT-ND4L mutations.
Measuring reactive oxygen species (ROS) production associated with MT-ND4L dysfunction requires sophisticated techniques that can capture these short-lived molecules with precision:
Amplex Red Assay: This fluorescence-based method specifically detects hydrogen peroxide (H₂O₂) through its reaction with Amplex Red in the presence of horseradish peroxidase (HRP). A standard protocol includes 20 mM Tris-HCl (pH 7.5), 30 μM NADH, 0.4 unit/mL HRP, and 10 μM Amplex Red at 30°C . The oxidation of Amplex Red to resorufin is monitored at 557–620 nm (ε = 51.6 mM⁻¹cm⁻¹) .
Differential ROS Detection: To distinguish between different types of ROS:
Redox State Correlation: Perform redox titrations by varying NAD⁺ concentration while maintaining constant NADH (30 μM) . This approach helps understand how the redox environment affects ROS production by MT-ND4L-containing complex I.
Parallel Measurements: For comprehensive assessment, simultaneously monitor:
NADH oxidation rates (at 340-420 nm)
Oxygen consumption using respirometry
Membrane potential using potentiometric dyes
ATP production rates
Controls and Validations: Include controls with specific complex I inhibitors to confirm that ROS production originates from complex I rather than other mitochondrial sources. Use purified complex I preparations from bovine or E. coli sources as reference standards .
These methodologies collectively provide a comprehensive profile of how MT-ND4L dysfunction affects ROS production, offering insights into potential mechanisms of cellular damage in conditions like LHON.
The association between MT-ND4L and metabolic disorders like obesity involves complex interactions between mitochondrial function, energy metabolism, and cellular signaling pathways:
Genetic Association Evidence: The MT-ND4L gene has been associated with obesity in several population studies . This association suggests that variations in this gene may influence metabolic efficiency or regulation in ways that affect body composition and energy balance.
Mechanistic Basis: As a component of respiratory complex I, MT-ND4L influences cellular energy production. Variants in this gene could potentially:
Alter the efficiency of NADH oxidation and electron transport
Modify the balance between ATP production and heat generation
Affect reactive oxygen species (ROS) production, which can influence insulin signaling pathways
Impact mitochondrial density and function in metabolically active tissues
Tissue-Specific Effects: The consequences of MT-ND4L variations may be particularly relevant in tissues with high energy demands or metabolic activity:
Adipose tissue: Affecting lipid storage and thermogenesis
Skeletal muscle: Influencing glucose uptake and utilization
Liver: Modifying gluconeogenesis and lipid metabolism
Hypothalamus: Potentially affecting energy sensing and appetite regulation
Mitochondrial-Nuclear Interactions: The effects of MT-ND4L variants likely depend on interactions with nuclear-encoded proteins, creating complex genotype-phenotype relationships that contribute to individual differences in metabolic efficiency and obesity risk .
Research Challenges: Definitively establishing causal relationships between MT-ND4L variants and obesity requires integration of genetic, biochemical, and physiological approaches. These should include detailed measurements of mitochondrial function in relevant tissues and correlation with metabolic parameters.
This emerging field highlights the importance of mitochondrial genetics in metabolic health and suggests potential new avenues for understanding and addressing obesity through mitochondrial-targeted interventions.
When designing experiments with recombinant MT-ND4L, implementing appropriate controls is crucial for generating reliable and interpretable results:
Protein Quality Controls:
Purity assessment through SDS-PAGE and Western blotting
Confirmation of proper folding via circular dichroism spectroscopy
Verification of expected molecular weight using mass spectrometry
Comparison with native MT-ND4L isolated from mitochondrial preparations
Enzymatic Activity Controls:
Inclusion of specific complex I inhibitors (e.g., rotenone) to confirm specificity of observed activities
Parallel assays with well-characterized complex I preparations (e.g., from bovine mitochondria or E. coli) as reference standards
Dose-response curves with varying protein concentrations to establish linearity of the assay
Time-course measurements to determine initial rate conditions
ROS Production Controls:
Addition of superoxide dismutase (SOD, 10 units/mL) and catalase (CAT, 1000 units/mL) to distinguish between different reactive oxygen species
Comparison of ROS production rates with and without NADH to establish substrate dependence
Control experiments under different redox conditions by varying the NAD⁺/NADH ratio
System-Specific Controls:
For reconstituted systems: lipid-only controls without protein
For membrane insertion studies: controls with known membrane proteins of similar size
For protein-protein interaction studies: non-interacting protein controls
Data Analysis Controls:
Multiple technical and biological replicates to ensure reproducibility
Statistical analysis appropriate for the experimental design
Normalization methods that account for variations in protein concentration or activity
These comprehensive controls ensure that observed effects can be confidently attributed to MT-ND4L function rather than experimental artifacts or contaminating activities.
Distinguishing between direct and indirect effects of MT-ND4L mutations requires a systematic experimental approach that isolates primary biochemical consequences from downstream cellular responses:
Hierarchical Experimental Design:
Begin with purified recombinant proteins to assess intrinsic biochemical properties of wild-type versus mutant MT-ND4L
Progress to reconstituted complex I systems to evaluate effects on assembly and electron transport
Advance to mitochondrial preparations to capture organelle-level consequences
Culminate with cellular models to observe systemic responses
Temporal Analysis:
Implement time-course experiments to establish the sequence of events following mutation introduction
Use inducible expression systems to control the timing of mutant protein expression
Identify early biochemical changes versus later compensatory responses
Specific Biochemical Parsing:
Directly measure parameters linked to MT-ND4L function (NADH oxidation, electron transport rates)
Assess secondary mitochondrial parameters (membrane potential, ATP production)
Evaluate tertiary cellular processes (calcium handling, apoptotic signaling)
Genetic Complementation Approaches:
Perform rescue experiments by expressing wild-type MT-ND4L in mutant backgrounds
Identify which phenotypes can be directly reversed by restoring normal MT-ND4L function
Use site-directed mutagenesis to create specific mutant variants for comparative functional studies
Correlation Analysis:
Establish quantitative relationships between the degree of MT-ND4L dysfunction and various downstream outcomes
Use statistical modeling to determine which effects show direct proportionality to primary defects
Account for threshold effects where small changes in primary function may trigger larger secondary responses
This structured approach allows researchers to construct causality chains from the primary biochemical defect to cellular pathology, distinguishing between direct consequences of MT-ND4L dysfunction and adaptive or maladaptive cellular responses.
Studying interactions between MT-ND4L and other mitochondrial proteins requires specialized techniques that account for the hydrophobic nature and membrane localization of these interactions:
Co-immunoprecipitation Adaptations:
Use mild detergents (digitonin, n-dodecyl-β-D-maltoside) for solubilization
Implement crosslinking prior to solubilization to stabilize transient interactions
Employ tag-based pulldown systems when working with recombinant proteins
Validate results with reciprocal immunoprecipitations using antibodies against different interaction partners
Native Gel Electrophoresis:
Blue Native PAGE separates intact protein complexes while preserving interactions
Subsequent second-dimension SDS-PAGE resolves individual components
Western blotting identifies specific proteins within complexes
This approach is particularly valuable for studying MT-ND4L integration into different complex I assembly intermediates
Proximity-Based Methods:
FRET pairs with fluorescently labeled proteins can detect close associations
Bioluminescence resonance energy transfer (BRET) offers an alternative with lower background
Proximity ligation assays provide in situ detection of protein interactions in fixed cells
These techniques can be adapted for live-cell imaging to capture dynamic interactions
Crosslinking Mass Spectrometry:
Apply specific crosslinkers that connect proteins in close proximity
Digest crosslinked complexes and analyze by LC-MS/MS
Identify peptides from MT-ND4L crosslinked to other proteins
This approach provides detailed information about interaction interfaces
Functional Interaction Assays:
Measure how the presence or absence of potential interaction partners affects MT-ND4L activity
Assess how MT-ND4L mutations impact the function of interacting proteins
Use reconstituted systems with defined components to control the interaction environment
These complementary approaches collectively provide a comprehensive view of MT-ND4L's interaction network, essential for understanding its role in complex I assembly, stability, and function.
Recombinant MT-ND4L offers a valuable platform for screening therapeutic compounds targeting mitochondrial diseases through several strategic approaches:
Target-Based Screening Systems:
Develop biochemical assays incorporating recombinant wild-type and mutant MT-ND4L (e.g., the Val65Ala variant associated with LHON)
Measure electron transport activity, focusing on NADH oxidation and ubiquinone reduction rates
Implement parallel assays for ROS production using Amplex Red or similar detection systems
Adapt assays to high-throughput formats compatible with large compound libraries
Mechanistic Screening Categories:
Compounds that improve electron transport efficiency in mutant MT-ND4L systems
Molecules that reduce aberrant ROS production without compromising energy generation
Agents that stabilize complex I assembly and prevent degradation of mutant subunits
Compounds that enhance alternative NADH oxidation pathways to bypass complex I defects
Validation Hierarchy:
Primary screens with recombinant protein or reconstituted enzyme systems
Secondary validation in isolated mitochondria containing the mutation of interest
Tertiary confirmation in cellular models (patient-derived cells or engineered cell lines)
Quaternary testing in appropriate animal models when available
Selection Criteria Optimization:
Define clear threshold values for hit identification based on statistical significance and magnitude of effect
Establish dose-response relationships to determine potency and efficacy
Assess specificity by testing effects on other respiratory chain complexes
Evaluate cytotoxicity profiles and potential off-target effects
Translational Pathway Development:
Characterize pharmacokinetic properties of promising compounds
Determine ability to cross mitochondrial membranes and blood-brain barrier when relevant
Assess formulation requirements for optimal delivery to affected tissues
Design rational combination strategies targeting multiple aspects of mitochondrial dysfunction
This systematic approach enables the identification and development of therapeutic candidates that specifically address MT-ND4L-related dysfunction in diseases like LHON, potentially leading to the first effective treatments for these devastating conditions.
Using MT-ND4L in comparative evolutionary studies requires careful attention to several methodological and analytical considerations:
Sequence Acquisition and Alignment:
Obtain high-quality sequence data from diverse species, including Pongo abelii and other primates
Implement appropriate alignment algorithms that account for the high hydrophobicity of MT-ND4L
Consider the unique constraints of mitochondrial DNA evolution, including maternal inheritance and lack of recombination
Pay particular attention to regions known to harbor pathogenic mutations, such as position 65 (site of the Val65Ala LHON mutation)
Evolutionary Rate Analysis:
Calculate substitution rates specifically for MT-ND4L across lineages
Compare rates with other mitochondrial genes to identify selection patterns
Distinguish between synonymous and non-synonymous substitutions to detect selective pressures
Analyze conservation patterns at sites of known human pathogenic mutations
Structural-Functional Correlations:
Map sequence variations onto structural models of complex I
Identify conserved domains likely essential for function versus variable regions that may confer species-specific adaptations
Correlate evolutionary changes with known functional domains for electron transport
Consider how species-specific variations might affect interaction with other complex I subunits
Adaptive Evolution Assessment:
Investigate potential adaptations related to metabolic demands across species
Consider environmental factors (temperature, oxygen levels) that might drive MT-ND4L evolution
Examine convergent evolution in species with similar metabolic adaptations
Analyze coevolution between MT-ND4L and interacting nuclear-encoded complex I subunits
Disease-Relevant Insights:
Identify natural variations in other species that correspond to human pathogenic mutations
Study compensatory mutations that might mitigate effects of otherwise deleterious changes
Use evolutionary information to predict the pathogenicity of novel human MT-ND4L variants
Develop evolutionary models to understand species-specific susceptibility to mitochondrial diseases
These approaches leverage evolutionary conservation and divergence to provide insights into both fundamental MT-ND4L function and the pathogenic mechanisms of human mutations, potentially identifying novel therapeutic targets.