Recombinant Pongo abelii Neuronal membrane glycoprotein M6-b (GPM6B)

Shipped with Ice Packs
In Stock

Description

Biological Functions and Mechanisms

GPM6B is implicated in diverse physiological processes:

Neural and Cellular Functions

  • Membrane Trafficking: Regulates serotonin transporter (SERT) localization by reducing surface expression, thereby modulating serotonin uptake .

  • Neural Development: Maintains actin cytoskeleton integrity in osteoblasts, influencing bone formation and matrix vesicle release .

  • Cellular Communication: Acts as a component of Schwann cell microvilli, preserving nodal integrity in peripheral nerves .

Species-Specific Roles

OrganismKey FunctionReference
Pongo abeliiNeural development, osteoblast function, SERT modulation
Homo sapiensMyelination, psychiatric disorder risk (e.g., Rett syndrome, hypomyelination)
Mus musculusBehavioral flexibility, delay discounting, serotonergic signaling

Behavioral and Psychiatric Studies

Mouse models with Gpm6b deletion exhibit:

  • Impaired Delay Discounting: Deficits in decision-making under delayed rewards .

  • Enhanced Reward Sensitivity: Improved performance in probabilistic reversal learning tasks .
    These findings link GPM6B to impulsive behaviors and psychiatric conditions like depression .

Oncology and Stem Cell Biology

In glioblastoma, higher GPM6B expression correlates with favorable prognosis and reduced mesenchymal identity by inhibiting the Wnt pathway . This suggests therapeutic potential in targeting glioma stem cells (GSCs).

Auditory Regeneration

AAV-mediated Gpm6b overexpression in cochlear organoids promotes:

  • Hair Cell (HC) Differentiation: Increased ectopic inner and outer HC regeneration .

  • Signaling Pathways: Activation of Wnt and Hippo pathways critical for inner ear development .

Comparative Analysis with Human GPM6B

FeaturePongo abelii GPM6B (Q5R603)Homo sapiens GPM6B (Q13491)
Gene LocationX chromosome (speculated) X chromosome, pseudogenes on Y/22
Transmembrane DomainsNot explicitly stated4 domains
Primary FunctionsNeural development, osteoblast regulation Myelination, SERT trafficking, oncogenesis

Challenges and Future Directions

While recombinant GPM6B from Pongo abelii provides a robust tool for studying its functions, challenges include:

  • Species-Specific Variations: Functional differences between primate and human GPM6B require further elucidation.

  • Therapeutic Translation: Optimization of delivery systems (e.g., AAV vectors) for clinical applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be finalized during the production process. If you have a preferred tag type, please inform us, and we will prioritize its inclusion.
Synonyms
GPM6B; M6B; Neuronal membrane glycoprotein M6-b; M6b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
GPM6B
Target Protein Sequence
MKPAMETAAEENTEQSQKRKGCFECCIKCLGGVPYASLVATILCFSGVALFCGCGHVALA GTVAILEQHFSTNASDHALLSEVIQLMQYVIYGIASFFFLYVIILLAEGFYTTSAVKELH GEFKTTACGRCISGMFVFLTYVLGVAWLGVFGFSAVPVFMFYNIWSTCEVIKSPQTNGTT GVEQICVDIRQYGIIPWNAFPGKICGSALENICNTNEFYMSYHLFIVACAGAGATVIALL IYMMATTYNYAVLKFKSREDCCTKF
Uniprot No.

Target Background

Function
GPM6B may play a role in neural development. It is involved in regulating osteoblast function and bone formation. Additionally, GPM6B is implicated in matrix vesicle release by osteoblasts, potentially involving the maintenance of the actin cytoskeleton. This protein may also contribute to cellular trafficking of SERT and thereby regulate serotonin uptake.
Database Links
Protein Families
Myelin proteolipid protein family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane.

Q&A

What is the structure and function of GPM6B in the central nervous system?

GPM6B is a membrane glycoprotein that belongs to the proteolipid protein family with a specific topology featuring four transmembrane domains (TMDs), two extracellular loops (EC1 and EC2), one intracellular loop (IC), and both N- and C-termini located at the cytoplasmic face . The protein is enriched in neurons, oligodendrocytes, and a subset of astrocytes in the central nervous system .

Functionally, GPM6B plays several critical roles:

  • Neuronal differentiation and development

  • Myelination processes

  • Regulation of serotonergic signaling through interaction with the serotonin transporter

  • Neurite outgrowth and neuronal polarization

  • Synapse formation and maintenance

GPM6B has also been implicated in various neuropsychiatric disorders, with human genome-wide association studies linking it to traits such as neuroticism, depressed affect, and delay discounting .

How does GPM6B expression vary across neural tissues and cell types?

GPM6B expression shows distinctive patterns across brain regions and cell types:

Brain RegionExpression LevelCell Types
HippocampusHighPrimarily neurons
CerebellumHighPrimarily neurons
StriatumHighPrimarily neurons
Prefrontal cortexHighPrimarily neurons
Other brain areasModerate to highNeurons, subset of astrocytes
Non-CNS tissuesLowLung, spleen, ovary, thyroid gland

A distinguishing feature of GPM6B within the PLP family is its neuronal expression pattern. While PLP is expressed only in glial cells and M6b is expressed in both neurons and glia, GPM6B is primarily located at the cell surface of neurons and epithelial cells of the choroid plexus . During development, GPM6B is concentrated at the edge of neuronal growth cones and their lamellipodia, suggesting its important role in neurite extension .

What experimental approaches are recommended for studying recombinant Pongo abelii GPM6B?

When working with recombinant Pongo abelii GPM6B, several methodological approaches are recommended:

Expression Systems:
The search results indicate successful expression of recombinant Pongo abelii GPM6B in yeast with a 6xHis tag at the N-terminus . This provides a starting point for researchers, though other expression systems may also be considered depending on research needs.

Experimental Applications:

  • ELISA for functional binding assays

  • Western blotting for protein detection and quantification

  • Immunoprecipitation for interaction studies

Protein Characteristics:

  • Expression region: 527-637 amino acids

  • Molecular weight: 19.8 kDa

  • Tags: N-terminal 10xHis-tag and C-terminal Myc-tag

  • Available forms: Liquid or lyophilized powder

When designing experiments, researchers should consider these characteristics to optimize protocols for protein handling, detection, and functional studies.

How do mutations in GPM6B affect behavioral phenotypes in model organisms?

Research using CRISPR-generated GPM6B mutant mice on C57BL/6J background has revealed several important behavioral effects:

Decision-Making Behaviors:

  • GPM6B deletion causes deficits in delay discounting tasks, suggesting increased impulsivity

  • Interestingly, reward sensitivity is enhanced in mutants, which facilitates behavioral flexibility

  • Improved performance is observed in probabilistic reversal learning tasks

These seemingly contradictory effects highlight the complex role of GPM6B in neural circuits involved in decision-making processes. Because GPM6B is located on the X chromosome, male mutant mice often show more pronounced phenotypes and have been the focus of behavioral studies .

The behavioral phenotypes observed in GPM6B mutant mice align with human GWAS findings that implicate this gene in psychiatric traits related to impulsivity and decision-making .

What signaling pathways mediate GPM6B's effects on neuronal development?

GPM6B influences neuronal development through multiple interconnected signaling pathways:

Neurite Outgrowth Pathways:
GPM6B activates several redundant signaling cascades that promote neurite extension:

  • Src/MAPK/ERK pathway

  • PKC pathway

  • PI3K/AKT pathway

Critical for this function is the phosphorylation of tyrosine 251 near GPM6B's C-terminus . The direct association between GPM6B's C-terminus and coronin1A (a cytoskeleton adaptor molecule) further verifies its essential role in projection extension .

Neuronal Polarity Induction:
GPM6B induces neuronal polarity through activation of the Rufy3-Rap2-STEF/Tiam2 pathway . This signaling cascade helps establish the axon-dendrite differentiation that is fundamental to neuronal function.

TGF-β-Related Signaling:
GPM6B can stimulate TGF-β-Smad2/3-related signaling pathways that participate in cellular differentiation processes . This pathway has been associated with:

  • Differentiation of osteoblasts and smooth muscle cells

  • Regulation of inner ear sensory epithelial cell status

  • Protection against aminoglycoside-induced hair cell loss

These multiple signaling mechanisms allow GPM6B to exert diverse effects on different aspects of neuronal development and function.

How can researchers effectively distinguish between GPM6B and other proteolipid protein family members?

Distinguishing between GPM6B and other members of the proteolipid protein family (particularly GPM6A and PLP/DM20) requires careful experimental design:

Sequence Comparison:
While M6a exhibits relatively low sequence identity with both PLP (38%) and M6b (52%), the transmembrane domains are highly conserved . Therefore, targeting unique regions for experimental manipulation is crucial.

Expression Pattern Analysis:
Researchers can exploit the differential expression patterns of PLP family members:

  • GPM6B: Predominantly expressed in neurons and choroid plexus epithelial cells

  • PLP: Expressed only in glial cells

  • M6b: Expressed in both neurons and glia

Molecular Tools for Specificity:

  • Design siRNAs targeting non-conserved regions

  • Generate antibodies against unique epitopes

  • Use CRISPR-based approaches with careful guide RNA design

  • Employ domain-specific tagging strategies

Functional Differentiation:
Focus on functions that appear more specific to GPM6B, such as:

  • Regulation of serotonergic signaling

  • Effects on delay discounting and behavioral flexibility

  • Specific interactions with the TGF-β pathway

By combining these approaches, researchers can more confidently attribute observed phenotypes to specific proteolipid protein family members.

What methodological considerations are important when using recombinant GPM6B in structural studies?

Structural studies of recombinant GPM6B present several methodological challenges that researchers should address:

Protein Stability and Solubility:
As a membrane protein with four transmembrane domains, GPM6B presents challenges for structural studies. Consider:

  • Detergent screening for optimal extraction and stability

  • Lipid nanodisc or amphipol reconstitution for maintaining native-like environment

  • Thermostability engineering for crystallization attempts

Post-Translational Modifications:
GPM6B undergoes several important post-translational modifications that may affect its structure and function:

  • Palmitoylation at multiple cysteine residues (C14, C17, C18, C21, C122, C125, C246)

  • N-glycosylation at N164 and N208

  • Phosphorylation at multiple sites including the critical Y251

Expression systems should be selected based on their ability to perform these modifications correctly.

Construct Design:

  • Consider truncation strategies to express functional domains separately

  • Use of fusion tags (His, GST, MBP) to improve solubility and purification

  • Removal of flexible regions that might impede crystallization

  • Creation of antibody-binding fragments for co-crystallization

Structural Analysis Methods:
Different techniques may be suitable depending on the specific research question:

  • X-ray crystallography for high-resolution static structures

  • Cryo-EM for visualization of larger complexes

  • NMR for dynamics studies of smaller domains

  • Hydrogen-deuterium exchange mass spectrometry for conformational information

The successful expression of recombinant Pongo abelii GPM6B in yeast with a 6xHis tag provides a starting point for structural studies , though optimization will likely be required for high-resolution structural analysis.

How can researchers study the role of GPM6B in serotonergic signaling?

Investigating GPM6B's role in serotonergic signaling requires a multi-faceted approach:

Molecular Interaction Studies:

  • Co-immunoprecipitation of GPM6B with serotonin transporters

  • Proximity ligation assays for in situ protein interaction detection

  • Surface plasmon resonance for binding kinetics

  • FRET/BRET approaches for dynamic interaction studies

Functional Assays:

  • Serotonin uptake and release measurements in cell culture models

  • Electrophysiological recordings of serotonergic neurons

  • Microdialysis for in vivo measurement of extracellular serotonin

  • Immunocytochemical analysis of serotonin transporter internalization

Genetic Manipulation Approaches:

  • Compare serotonergic function in GPM6B knockout vs. wild-type models

  • Design rescue experiments with wild-type or mutant GPM6B

  • Generate point mutations at key residues involved in serotonin transporter interactions

Behavioral Paradigms:
GPM6B mutant mice show specific behavioral phenotypes related to serotonergic function, including:

  • Alterations in delay discounting (a measure of impulsivity)

  • Changes in behavioral flexibility

  • Effects on sensorimotor gating

These behavioral paradigms can be combined with pharmacological challenges using serotonergic drugs to further elucidate GPM6B's role in this neurotransmitter system.

What is known about the potential role of GPM6B in hair cell reprogramming?

Recent research has uncovered an unexpected role for GPM6B in hair cell reprogramming in the cochlea:

Mechanism and Pathways:
AAV-mediated GPM6B expression appears to support hair cell reprogramming through:

  • Stimulation of TGF-β-Smad2/3-related signaling pathways

  • Upregulation of TGF-β1 after GPM6B overexpression

Functional Implications:

  • TGF-β signaling pathway is associated with the regulation of inner ear sensory epithelial cell status

  • TGF-β1 is expressed in the inner ear and enhances the protective effect of GDNF against ototoxicity

  • This protective effect may be particularly relevant to aminoglycoside-induced hair cell loss

Potential Applications:
This finding suggests potential therapeutic applications for GPM6B in hearing loss, particularly:

  • Supporting cochlear supporting cell (SC) differentiation into hair cells

  • Protection against ototoxic damage

  • Enhancing the efficacy of other protective factors like GDNF

This represents an emerging area of GPM6B research that warrants further investigation, particularly given the irreversible nature of cochlear hair cell damage and the resulting hearing loss.

What experimental design considerations are crucial when studying GPM6B in behavioral contexts?

When designing behavioral experiments to study GPM6B function, several methodological considerations are critical:

Sex Differences:
Because GPM6B is located on the X chromosome, sex differences in phenotypic expression are particularly important:

  • Male models will show immediate effects of knockout due to hemizygosity

  • Female models require careful consideration of X-inactivation effects

  • Both sexes should be included in experimental designs with appropriate analysis

Control Selection:

  • Use wild-type littermates as controls to minimize genetic background variations

  • Consider including heterozygous animals when studying gene dosage effects

  • Inclusion of GPM6A knockout or GPM6A/GPM6B double knockout models may help assess functional redundancy

Behavioral Task Selection:
Based on known GPM6B functions, include assessments of:

  • Delay discounting and other impulsivity-related behaviors

  • Behavioral flexibility measurements (e.g., probabilistic reversal learning)

  • Measures of sensorimotor gating (prepulse inhibition)

Developmental Timing:

  • Consider the developmental stage at which GPM6B function is being assessed

  • For genetic manipulations, use of inducible systems can help distinguish between developmental and adult requirements

  • Track age-dependent changes in phenotype expression

Interpretation Challenges:
Researchers should be aware of the seemingly contradictory effects observed in different behavioral paradigms:

  • Deficits in delay discounting suggest increased impulsivity

  • Enhanced reward sensitivity facilitates behavioral flexibility in reversal learning tasks

These apparent contradictions likely reflect the complex role of GPM6B in different neural circuits and may provide insight into its function in various neuropsychiatric conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.