Recombinant Pongo abelii Nucleoporin NDC1 (TMEM48)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Characterization

Nucleoporin NDC1, also known as TMEM48 (Transmembrane protein 48), is a fundamental component of the nuclear pore complex (NPC). The Pongo abelii (Sumatran orangutan) variant of this protein exhibits specific characteristics that make it valuable for both research and commercial applications. The protein belongs to the NDC1 family and consists of 674 amino acids with a molecular mass of approximately 76.1 kDa . The recombinant form can be produced as either a full-length protein or as partial protein fragments, depending on research requirements .

NDC1 is identified by several synonyms in scientific literature, including HNDC1, NET3, and TMEM48 . The UniProt identification number for Pongo abelii NDC1 is Q5RBY5, providing standardized reference information for researchers . This transmembrane nucleoporin is highly conserved across species, indicating its evolutionary importance in eukaryotic cell function.

Functional Properties of NDC1

Nucleoporin NDC1 plays essential roles in nuclear envelope architecture and function. As a critical component of the nuclear pore complex, NDC1 serves as an anchoring protein that helps establish and maintain the structure of nuclear pores .

Role in Nuclear Pore Complex Assembly

NDC1 is fundamentally involved in the de novo assembly and insertion of nuclear pore complexes into the nuclear envelope. It forms a critical link between the nuclear envelope membrane and soluble nucleoporins, effectively anchoring the NPC within the membrane . This anchoring function is essential for maintaining proper nucleocytoplasmic transport, a process vital for cellular function and viability.

Research on yeast Ndc1 (a homolog of the primate protein) has demonstrated that it forms distinct complexes with other nuclear pore components. While the specific interactions may differ between yeast and primates, research suggests that NDC1 likely forms similar interaction networks in higher eukaryotes, including Pongo abelii . These interactions create a stable framework for the nuclear pore complex, ensuring its structural integrity and functional capacity.

Interaction Network

Studies in yeast have shown that Ndc1 forms complexes with various nucleoporins, including transmembrane proteins like Pom152 and Pom34, as well as soluble nucleoporins such as Nup53 and Nup59 . These proteins, in turn, interact with core nucleoporins like Nup170 and Nup157, establishing connections between the pore membrane and the core of the nuclear pore complex . While the specific interaction partners may differ in Pongo abelii, the functional principles are likely conserved.

Disruption of these interaction networks in experimental systems has been shown to cause severe structural abnormalities in the nuclear pore complex, including significant pore dilation . This underscores the critical role of NDC1 and its binding partners in maintaining nuclear envelope integrity and appropriate nuclear pore structure.

Recombinant Production and Characteristics

Recombinant Pongo abelii Nucleoporin NDC1 (TMEM48) is typically produced in Escherichia coli expression systems, allowing for controlled production of the protein for research and commercial applications . The recombinant protein can be produced in both full-length and partial forms, depending on the specific requirements of the application.

Physical Characteristics and Quality Control

Commercially available recombinant NDC1 typically undergoes rigorous quality control to ensure consistency and reliability. The protein exhibits a characteristic migration pattern on SDS-PAGE, corresponding to its molecular weight of approximately 76.1 kDa, although the apparent weight may vary depending on tag type and expression conditions .

When visualized on Western blots, NDC1 shows characteristic banding patterns that can be used for identification and validation. These physical characteristics serve as important quality control parameters for researchers utilizing the recombinant protein .

Reconstitution Protocol

For lyophilized preparations, a specific reconstitution protocol is recommended:

  1. Centrifuge the vial briefly prior to opening to bring contents to the bottom

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) for long-term storage

  4. Aliquot the solution to minimize freeze-thaw cycles and store at -20°C/-80°C

This protocol ensures optimal protein stability and activity for subsequent applications.

Research Applications and Significance

Recombinant Pongo abelii NDC1 has significant applications in various research fields, particularly in studies focusing on nuclear envelope structure and function, nucleocytoplasmic transport, and comparative primate biology.

Comparative Primate Biology

The availability of recombinant Pongo abelii NDC1 provides opportunities for comparative studies between different primate species. By examining the structural and functional conservation of this protein across primates, researchers can gain insights into the evolution of nuclear pore complexes and nuclear envelope organization .

Such comparative studies may also have implications for understanding species-specific differences in cellular processes and disease susceptibility, particularly those involving nuclear function and nucleocytoplasmic transport.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preference when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
NDC1; TMEM48; Nucleoporin NDC1; Transmembrane protein 48
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-674
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
NDC1
Target Protein Sequence
MATAVSGPCAGRSRDILWRVLGWRIVASIIWSVLLLPICTTVFIIFSRIDLFHPIQWLSD SFSDLYSSYVIFYLLLLSVVIIIISIFNVEFYAVVPSIPCSRLALIGKIIHPQQLMHSFI HAAMGMVMAWCAAVITQGQYSFLVVPCTGANSFGSPAAQTCLNEYHLFFLLAGALMGYSY SLLYFVNNMNYLPFPIIQQYKFLRFRRSLLLLVKHSCVESLFLVRNFCILYYFLGYIPKA WISTAMNLHIDEQVHRPLDTVSGLLNLSLLYHVWLCGAFLLTTWYVSWILFKIYATEAHV FPVQPPFAEGSDECLPKVLNSNPPPIIKYLALQDLMLFSQYSPSRRQEVFSLSQPGGHPH NWTAISRECLNLLNGMTQKLVLYQEAAATNGRVSSSYPVEPKKLNSPEETTFQTPKSSQM PRPSVPPLVKTSLFSSKLSTPEVVSPFGTPFGSSVMNRMAGIFDVNTCFGSPQSPQLIRR GPRLWTSASDQQMTEFSNPSPSTSISAEGKTMRQPSVIYSWIQNKREQIKNFLSKRVLIM YFFSKHPEASIQAVFSDAQMHIWALEGLSHLVAASFTEDRFGVVQTTLPAILNTLLTLQE AVDKYFKLPHASSKPPRISGSLVDTSYKTLRFAFRASLKTAIYRITTTFGEHLNAVQASA EHQKRLQQFLEFKE
Uniprot No.

Target Background

Function
Nucleoporin NDC1 (TMEM48) is a component of the nuclear pore complex (NPC), playing a crucial role in the de novo assembly and insertion of NPCs into the nuclear envelope. It is essential for NPC and nuclear envelope assembly, possibly by acting as a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC within the membrane.
Database Links
Protein Families
NDC1 family
Subcellular Location
Nucleus, nuclear pore complex. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is Nucleoporin NDC1 (TMEM48) and what is its primary function in cells?

Nucleoporin NDC1, also known as TMEM48, is a transmembrane protein that serves as a critical component of nuclear pore complexes (NPCs). These large proteinaceous channels are embedded in the nuclear envelope and facilitate the exchange of molecules between the nucleus and cytoplasm . The primary function of NDC1 is to anchor the NPC in the nuclear membrane, essentially creating a physical bridge between the nuclear envelope and soluble nucleoporins .

NDC1 is evolutionarily conserved from yeast to metazoans, indicating its fundamental importance in eukaryotic cell biology . In vertebrates, NDC1 plays a crucial role in both NPC assembly and nuclear envelope formation. Research using RNA interference (RNAi) and biochemical depletion has demonstrated that NDC1 is essential for these processes both in vivo and in vitro . In particular, NDC1 interacts with other nucleoporins such as Nup53, forming a critical link that stabilizes the entire nuclear pore complex within the nuclear membrane .

How does the structure of Pongo abelii NDC1 compare to human NDC1?

Pongo abelii (Sumatran orangutan) NDC1 shares significant structural homology with human NDC1, reflecting their close evolutionary relationship. Both are transmembrane proteins with similar domain organization that allows them to anchor within the nuclear envelope while interacting with soluble nucleoporins .

The conservation of NDC1 across primates is particularly relevant for comparative studies of nuclear pore complex assembly and function. While specific structural details of Pongo abelii NDC1 are not extensively characterized in the provided search results, genomic studies indicate high sequence conservation among great apes . This conservation allows researchers to use recombinant Pongo abelii NDC1 as a model for understanding human NDC1 function, particularly in contexts where using human proteins presents technical or ethical challenges.

Research using ancestry informative markers and genomic targets has shown that transmembrane proteins like NDC1 can provide valuable insights into the evolutionary relationships between orangutan species (Pongo abelii, Pongo tapanuliensis, and Pongo pygmaeus) , while also serving as useful models for human cellular processes.

What protein interactions are crucial for NDC1 function in nuclear pore complexes?

NDC1 participates in multiple crucial protein interactions that enable proper nuclear pore complex structure and function. These interactions can be categorized into two main groups:

  • Interactions with transmembrane nucleoporins:

    • NDC1 forms a distinct complex with the transmembrane proteins Pom152 and Pom34 (in yeast)

    • These interactions help stabilize NDC1 within the nuclear membrane

  • Interactions with soluble nucleoporins:

    • NDC1 forms alternative complexes with Nup53 and Nup59

    • Nup53 and Nup59 in turn bind to Nup170 and Nup157

    • The interaction with Nup53 is particularly important for anchoring the NPC to the nuclear envelope

Experimental evidence using in vitro binding assays has confirmed the direct interaction between NDC1 and Nup53, supporting the model that NDC1 functions by linking the nuclear envelope membrane to soluble nucleoporins, thereby anchoring the NPC in the membrane .

How can researchers effectively design experiments to study NDC1/TMEM48 function?

Designing effective experiments to study NDC1/TMEM48 function requires careful consideration of experimental approaches that can reveal its roles in nuclear pore complex (NPC) assembly and function. Here is a methodological framework:

  • Blocking design for protein interaction studies:

    • Implement blocking in experimental design to group similar experimental units, reducing variability within each experimental block

    • This approach is particularly valuable when studying NDC1 interactions with different nucleoporins, as it allows for more precise detection of interaction effects

    • Example: When testing NDC1-Nup53 interactions under different conditions, group experiments by cell type or environmental condition to minimize extraneous variables

  • Power analysis for detection of functional changes:

    • Calculate required sample sizes to detect meaningful functional changes in NDC1-depleted systems

    • Reduced variability through proper experimental design enhances statistical power to detect true effects of NDC1 manipulation

  • Bias reduction through proper controls:

    • Include appropriate controls to minimize experimental bias

    • For NDC1 functional studies, this includes:

      • Wild-type cells as positive controls

      • Cells expressing mutant versions of NDC1 with specific domains altered

      • Cells with knockdown/knockout of interacting partners (e.g., Nup53)

  • Combined approaches for comprehensive analysis:

    • RNA interference (RNAi) to deplete NDC1 and observe functional consequences

    • Biochemical immunodepletion in cell-free systems to study direct effects on NPC assembly

    • Fluorescent protein tagging (including photoconvertible variants) to track NDC1 localization and dynamics during NPC assembly

    • Co-immunoprecipitation to identify and confirm interaction partners

This methodological framework ensures that experiments studying NDC1 function are robust, reproducible, and capable of detecting true biological effects while minimizing confounding factors.

What is the significance of TMEM48 in cancer research and how does this relate to its nuclear pore function?

TMEM48 (NDC1) has emerged as a significant protein in cancer research, particularly in relation to cervical cancer (CC). Recent studies have revealed that TMEM48 is overexpressed in CC tissues and cell lines, suggesting a role in cancer progression . The significance of this finding extends beyond simple correlation, as functional studies have demonstrated that TMEM48 actively promotes cancer cell proliferation, migration, and invasion both in vitro and in vivo .

The relationship between TMEM48's cancer-promoting activities and its canonical nuclear pore function presents an intriguing research area. Several key findings illuminate this connection:

  • TMEM48 knockdown effects on cancer cells:

    • Significantly inhibits cell proliferation

    • Reduces cell migration and invasion capabilities

    • Suppresses tumor growth in xenograft models

  • Molecular mechanism involving Wnt/β-catenin pathway:

    • TMEM48 downregulation decreases protein levels of β-catenin, TCF1, and AXIN2 in CC cells

    • These proteins are key components of the Wnt/β-catenin signaling pathway

    • TMEM48 appears to promote CC progression through activation of this pathway

The connection between nuclear pore function and cancer progression likely involves altered nucleocytoplasmic transport of regulatory proteins and transcription factors. As a transmembrane nucleoporin, TMEM48 could influence the import/export of molecules that regulate cell cycle progression, thereby affecting cancer cell proliferation when its expression is dysregulated.

This dual role—structural component of the nuclear pore and modulator of cancer-related signaling pathways—makes TMEM48 a promising therapeutic target for CC treatment . These findings suggest that disrupting TMEM48 function could potentially inhibit cancer progression through multiple mechanisms.

What approaches can be used to study NDC1/TMEM48 in non-human primate models like Pongo abelii?

Studying NDC1/TMEM48 in non-human primate models like Pongo abelii (Sumatran orangutan) requires specialized approaches that account for both the practical constraints of working with protected species and the scientific value of comparative analysis. Here are methodological approaches for such research:

These methodological approaches enable researchers to study TMEM48 in Pongo abelii while respecting ethical considerations and sample limitations associated with research on endangered species. The comparative analysis of TMEM48 across different orangutan species and other primates can provide valuable insights into the evolution and conservation of nuclear pore complex components.

How can researchers differentiate between the nuclear transport and signaling functions of NDC1/TMEM48?

Differentiating between the canonical nuclear transport role and signaling functions of NDC1/TMEM48 requires sophisticated experimental approaches that can separate these potentially overlapping functions. Here is a methodological framework:

  • Domain-specific mutant analysis:

    • Generate recombinant NDC1/TMEM48 constructs with mutations in specific functional domains

    • Transmembrane domain mutations: Disrupt nuclear envelope localization

    • Nup53-binding domain mutations: Maintain membrane localization but disrupt NPC anchoring

    • Compare phenotypes resulting from these distinct mutants to differentiate functions

  • Spatiotemporal analysis using advanced microscopy:

    • Employ photoconvertible fluorescent protein fusions (as demonstrated with other nucleoporins)

    • This approach allows tracking of newly synthesized NDC1/TMEM48 versus existing protein

    • Can reveal whether signaling functions occur before or after nuclear envelope integration

  • Separation of functions through interactor depletion:

    • Systematically deplete known NDC1 interactors (Nup53, Nup59, Pom152, Pom34)

    • Measure both nuclear transport efficiency and signaling pathway activation (e.g., Wnt/β-catenin pathway)

    • Identify which interactions are critical for transport versus signaling functions

  • Biochemical fractionation and activity assays:

    • Isolate NDC1/TMEM48 from different cellular compartments (nuclear envelope, cytoplasmic vesicles)

    • Test fractions for different biochemical activities related to:

      • Nuclear pore complex stability

      • Interaction with signaling components like β-catenin

      • Ability to activate downstream transcriptional targets

  • Temporal manipulation using inducible systems:

    • Implement rapid protein degradation systems (e.g., auxin-inducible degron)

    • Observe immediate effects on nuclear transport

    • Compare with delayed effects on signaling pathways

    • Differences in timing can help distinguish direct from indirect functions

This integrated approach allows researchers to dissect the multifunctional nature of NDC1/TMEM48, determining which cellular phenotypes result from its nuclear transport function versus its potential roles in signaling pathways that affect cell proliferation and other cancer-relevant processes.

What are the current challenges in purifying functional recombinant NDC1/TMEM48 and how can they be addressed?

Purifying functional recombinant NDC1/TMEM48 presents significant challenges due to its transmembrane nature and complex role in nuclear pore assembly. Here are the key challenges and methodological approaches to address them:

  • Membrane protein solubility challenges:

    • NDC1/TMEM48 contains multiple transmembrane domains that make it prone to aggregation during expression and purification

    • Solution: Utilize specialized expression systems optimized for membrane proteins:

      • Yeast expression systems (demonstrated for Pongo abelii proteins)

      • Insect cell/baculovirus systems that provide eukaryotic processing capabilities

      • Mammalian expression systems for full post-translational modifications

  • Maintaining native conformation:

    • Preserving the functional conformation of NDC1 is critical for interaction studies

    • Solution: Implement these approaches:

      • Use mild detergents specifically optimized for nuclear membrane proteins

      • Consider membrane mimetics (nanodiscs, amphipols) to maintain native-like environment

      • Partial construct approaches: Express functional domains separately when full-length protein proves recalcitrant

  • Functional validation challenges:

    • Determining if purified recombinant NDC1 retains native activity is difficult

    • Solution: Develop robust functional assays:

      • In vitro binding assays with known partners like Nup53

      • Reconstitution into proteoliposomes to test membrane integration

      • Complementation assays in NDC1-depleted systems

  • Expression yield optimization:

    • Transmembrane proteins often express at lower levels than soluble proteins

    • Solution: Strategic construct design:

      • Codon optimization for expression host

      • Addition of solubility-enhancing tags (MBP, SUMO)

      • Inducible promoters with fine-tuned expression conditions

      • Consider expression as separate domains followed by reconstitution

Expression SystemAdvantagesChallengesBest Applications
Yeast (e.g., P. pastoris)Eukaryotic processing, membrane protein handlingModerate yields, glycosylation differencesStructure-function studies
E. coliHigh yield, cost-effectiveInclusion bodies, lack of processingBinding domain studies, antibody generation
BaculovirusHigh-level expression, eukaryotic processingMore complex setup, longer timelineFull-length functional studies
Mammalian cellsNative-like processing, proper foldingLower yields, highest costSignaling studies, therapeutic applications

By systematically addressing these challenges through optimized expression systems and purification strategies, researchers can obtain functional recombinant NDC1/TMEM48 suitable for detailed biochemical, structural, and functional studies.

How can researchers design experiments to study the role of NDC1/TMEM48 in nuclear pore complex assembly?

Designing experiments to study NDC1/TMEM48's role in nuclear pore complex (NPC) assembly requires sophisticated approaches that capture the dynamic and multifaceted nature of this process. Here is a comprehensive methodological framework:

  • In vitro reconstitution assays:

    • Xenopus egg extract system: A powerful cell-free system that recapitulates nuclear envelope and NPC assembly

    • Methodology:

      • Immunodeplete endogenous NDC1 from egg extracts

      • Add back recombinant wild-type or mutant NDC1 variants

      • Assess NPC formation using electron microscopy and immunofluorescence

      • Quantify incorporation of other nucleoporins as a measure of successful assembly

  • Live-cell imaging with photoconvertible fluorescent proteins:

    • Methodology demonstrated in yeast studies on nucleoporins :

      • Tag NDC1 and partner nucleoporins with photoconvertible fluorescent proteins

      • Photoconvert existing proteins to distinguish from newly synthesized proteins

      • Track the spatiotemporal dynamics of new NPC formation

      • This approach revealed that depletion of Pom34 in cells lacking NUP53 and NUP59 blocks new NPC assembly

  • Sequential depletion experiments:

    • Design factorial experiments to determine the hierarchy of dependencies:

      • Deplete NDC1 first, then other nucleoporins, or vice versa

      • Assess which depletions phenocopy others

      • Use blocking experimental design to control for variability

      • This approach can establish the sequence of recruitment during NPC assembly

  • Domain mapping through interaction studies:

    • Systematically map interaction domains between NDC1 and partners:

      • Generate truncations and point mutations in NDC1's Nup53-binding region

      • Test interactions using quantitative binding assays

      • Correlate binding affinities with functional outcomes in NPC assembly

      • The established interaction between NDC1 and Nup53 is crucial for anchoring the NPC

  • Crosslinking mass spectrometry:

    • Apply crosslinking followed by mass spectrometry to capture transient interactions during assembly:

      • Use membrane-permeable crosslinkers to stabilize NDC1 interactions

      • Identify crosslinked peptides to map interaction interfaces at amino acid resolution

      • This approach can reveal assembly intermediates not detectable by other methods

  • Genetic complementation matrix:

    • In model systems like yeast:

      • Create combinatorial deletions of NDC1 and interacting partners

      • Test which combinations are synthetic lethal or show enhanced phenotypes

      • This approach revealed that transmembrane (Pom152, Pom34) and soluble (Nup53, Nup59) NDC1-binding partners have redundant functions

Experimental ApproachKey MeasurementsAdvantagesLimitations
In vitro reconstitutionNPC density, nucleoporin incorporationBiochemical control, quantitativeSimplified system
Live-cell imagingAssembly kinetics, spatial organizationDynamic information, in vivo relevanceTechnical complexity
Depletion experimentsAssembly defects, compensatory mechanismsFunctional insights, hierarchy determinationIndirect effects
Domain mappingBinding affinities, interaction surfacesMolecular precision, structure-function relationshipStatic information
Crosslinking MSInteraction interfaces, assembly intermediatesHigh resolution, transient interactionsSample preparation challenges
Genetic approachesSynthetic phenotypes, functional redundancyIn vivo relevance, systems-level insightsPotential adaptation

By combining these methodological approaches, researchers can develop a comprehensive understanding of NDC1/TMEM48's role in the complex process of nuclear pore assembly, from molecular interactions to functional outcomes in living cells.

What can studying Pongo abelii NDC1/TMEM48 tell us about human nuclear pore complex evolution?

Studying Pongo abelii NDC1/TMEM48 provides a valuable evolutionary window into human nuclear pore complex (NPC) development. The methodological value of comparative studies between human and orangutan NDC1 lies in their evolutionary relationship—orangutans being one of our closest living relatives with the genus Pongo diverging from the human lineage approximately 12-16 million years ago.

  • Evolutionary rate analysis:

    • By comparing NDC1/TMEM48 sequences between Pongo abelii and humans:

      • Researchers can identify rapidly evolving versus conserved regions

      • Conservation indicates functional constraints and essential domains

      • Divergent regions may represent species-specific adaptations or relaxed selection

    • Methodology should include calculation of dN/dS ratios across the gene to detect signatures of selection

  • Structural conservation implications:

    • The core function of NDC1 in anchoring nuclear pore complexes to the nuclear envelope appears conserved across species

    • Comparative structural biology approaches can reveal:

      • Conservation of transmembrane domains that anchor NDC1 in the nuclear envelope

      • Conservation of Nup53-binding regions critical for NPC attachment

      • Species-specific structural adaptations that may reflect differences in nuclear transport requirements

  • Cancer-related functional divergence:

    • TMEM48 promotes cell proliferation in human cervical cancer through Wnt/β-catenin pathway activation

    • Comparative oncology approach:

      • Study whether Pongo abelii TMEM48 has similar effects on cell proliferation

      • Compare effects on downstream signaling pathways (β-catenin, TCF1, AXIN2)

      • Differences may reveal how nuclear pore components evolved additional regulatory functions in humans

  • Genomic context analysis:

    • Analyzing the genomic neighborhood of NDC1/TMEM48 across primates can reveal:

      • Conservation or divergence of regulatory elements

      • Gene duplication events that may have led to subfunctionalization

      • Methodology should utilize ancestry informative markers (AIMs) and population genomic approaches described for orangutan studies

The comparative genomic approach between humans and Pongo abelii can particularly benefit from reduced-representation sequencing techniques that allow targeted study of NDC1/TMEM48 and related genes even from limited DNA samples . This approach enables researchers to construct evolutionary models of nuclear pore complex development across the primate lineage, potentially revealing how this fundamental cellular structure has adapted during human evolution while maintaining its essential functions.

What are common challenges in expressing and purifying recombinant Pongo abelii NDC1/TMEM48, and how can researchers overcome them?

Expressing and purifying recombinant transmembrane proteins like Pongo abelii NDC1/TMEM48 presents several technical challenges. Here are methodological approaches to overcome these common obstacles:

  • Expression system selection challenges:

    • Different expression systems offer varying advantages for transmembrane proteins

    • Methodological solution:

      • Systematically test multiple expression systems as demonstrated for other Pongo abelii proteins:

        • Yeast systems: Appropriate for membrane proteins with eukaryotic processing requirements

        • E. coli systems: Higher yield but potential folding issues

        • Baculovirus systems: Better for complex eukaryotic proteins

        • Mammalian cell systems: Optimal for native folding and post-translational modifications

      • Optimize expression conditions for each system (temperature, induction time, media composition)

  • Protein solubility and aggregation issues:

    • Transmembrane proteins often aggregate during expression

    • Methodological solution:

      • Implement fusion tags that enhance solubility:

        • Avi-tag biotinylation approach (as demonstrated for other Pongo abelii proteins)

        • Solubility-enhancing partners (MBP, SUMO, thioredoxin)

      • Optimize detergent selection for extraction:

        • Screen detergent panels (mild non-ionic to stronger ionic detergents)

        • Consider lipid nanodiscs or amphipols for native-like membrane environment

  • Protein yield optimization:

    • Low expression levels common for complex transmembrane proteins

    • Methodological solution:

      • Scale optimization:

        • Move from small-scale test expressions (2mg) to larger preparations as needed

        • Implement high cell-density fermentation techniques

      • Codon optimization for expression host

      • Consider expressing functional domains separately if full-length protein yields are prohibitively low

  • Functional validation challenges:

    • Confirming that purified protein retains native activity

    • Methodological solution:

      • Develop activity assays based on known NDC1 functions:

        • In vitro binding assays with known partners like Nup53

        • Liposome reconstitution to test membrane integration

        • Complementation assays in cells depleted of endogenous NDC1

ChallengeCommon SymptomsMethodological Solutions
Poor expressionLow yield, no visible bandSwitch expression system; optimize induction conditions; use stronger promoters
AggregationProtein in inclusion bodies or void volumeScreen detergents; reduce expression temperature; use solubility tags
DegradationMultiple smaller bands on SDS-PAGEAdd protease inhibitors; reduce expression time; purify at 4°C
Inactive proteinNo functional activity in assaysOptimize purification buffer; use milder solubilization conditions; verify proper folding
Difficult detectionWeak western blot signalUse epitope tags; generate specific antibodies; optimize transfer conditions for membrane proteins

By systematically addressing these challenges using the outlined methodological approaches, researchers can successfully express and purify functional recombinant Pongo abelii NDC1/TMEM48 for detailed biochemical and functional studies.

How can researchers design experiments to reconcile conflicting data about NDC1/TMEM48 function?

When researchers encounter conflicting data regarding NDC1/TMEM48 function—such as discrepancies between its canonical role in nuclear pore assembly versus emerging roles in signaling pathways like Wnt/β-catenin—methodological approaches to reconcile these data become essential. Here's a framework for designing experiments to address such conflicts:

  • Controlled variable isolation:

    • Apply experimental design principles to isolate variables that might explain discrepancies:

      • Block experimental units to reduce variability and increase detection power

      • Control for cell type, developmental stage, and environmental conditions

      • Standardize protein expression levels across experimental systems

  • Multidimensional analysis approach:

    • Design factorial experiments that simultaneously vary multiple parameters:

      • Cell/tissue type (differentiated vs. cancer cells)

      • NDC1/TMEM48 expression level (normal, overexpressed, depleted)

      • Subcellular localization (wild-type vs. mislocalized mutants)

      • Interacting partner availability (with/without Nup53, etc.)

    • This approach can reveal context-dependent functions that explain apparent contradictions

  • Temporal resolution of functions:

    • Implement time-course experiments with high temporal resolution:

      • Use inducible expression/degradation systems

      • Apply photoconvertible protein approaches as demonstrated for nucleoporins

      • Correlate changes in nuclear pore function with signaling pathway activation

    • This can determine whether different functions occur sequentially rather than simultaneously

  • Domain-specific functional mapping:

    • Generate a panel of domain-specific mutants:

      • Separate mutations affecting nuclear pore localization

      • Distinct mutations disrupting signaling functions

      • Test each mutant across multiple functional assays

    • This approach can determine whether different protein domains mediate distinct functions

  • Mathematical modeling for integrated understanding:

    • Develop computational models that incorporate multiple NDC1 functions:

      • Model nuclear pore assembly kinetics

      • Integrate with signaling pathway dynamics

      • Test whether a unified model can explain apparently conflicting observations

    • Use sensitivity analysis to identify parameters that most strongly influence outcomes

  • Systematic replication with standardized protocols:

    • Implement identical protocols across different lab environments:

      • Standardize cell lines, reagents, and experimental conditions

      • Perform blinded analyses to reduce experimenter bias

      • This approach can determine whether conflicting results stem from methodological differences

Conflict SourceExampleResolution Strategy
Cell type dependenceFunction differs in cancer vs. normal cellsParallel experiments in multiple cell types with identical conditions
Temporal dynamicsShort-term vs. long-term consequences differHigh-resolution time course with multiple readouts
Protein-level effectsDifferent expression levels show opposing effectsTitration experiments with precise expression control
Indirect vs. direct effectsPrimary vs. secondary consequences of NDC1 manipulationAcute vs. chronic manipulation comparisons
Technical artifactsDifferent assay systems yield contradictory resultsCross-validation with orthogonal techniques

By implementing these methodological approaches, researchers can systematically address contradictions in the literature regarding NDC1/TMEM48 function, potentially revealing how this protein integrates its roles in nuclear pore assembly and cellular signaling in a context-dependent manner.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.