Recombinant Pongo abelii Opalin (OPALIN)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
OPALIN; TMEM10; Opalin; Oligodendrocytic myelin paranodal and inner loop protein; Transmembrane protein 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
OPALIN
Target Protein Sequence
MSFSLNFTLPANTTSSPVTGGKETDCGPSLGLAAGIPSLVATALLVALLFTLIHRRRSSI EAMEESDRPCEISEIDDSPKISENPRRSPTHEKNTMGAQEAHIYVKTAAGSEEPVHDRYR PTIEMERRRGLWWLVPRLSLE
Uniprot No.

Target Background

Function

A central nervous system-specific myelin protein that enhances myelin gene expression during oligodendrocyte differentiation and promotes their terminal differentiation.

Database Links

KEGG: pon:100174048

UniGene: Pab.893

Subcellular Location
Cell membrane; Single-pass type I membrane protein.

Q&A

What is OPALIN and what is its basic function in neural tissue?

OPALIN (Oligodendrocytic myelin paranodal and inner loop protein), also known as Transmembrane protein 10 (TMEM10), is a protein expressed primarily in oligodendrocytes. Recent research has identified OPALIN as a receptor for Leucine-rich glioma-inactivated protein 1 (LGI1) that plays a critical role in oligodendrocyte differentiation . OPALIN strongly colocalizes with Myelin Basic Protein (MBP) in the mouse brain and is extensively expressed on the protrusions and membranes of primary cultured oligodendrocytes . Functionally, OPALIN is essential for proper oligodendrocyte development and myelination, as demonstrated by knockout studies where OPALIN deletion resulted in reduced numbers of mature oligodendrocytes without affecting oligodendrocyte precursor cells (OPCs) .

How is OPALIN expression regulated during oligodendrocyte development?

OPALIN expression is developmentally regulated during oligodendrocyte maturation. Research indicates that OPALIN is predominantly expressed in mature oligodendrocytes rather than in OPCs. This is supported by knockout studies showing that OPALIN deletion specifically reduces the CC1+ mature oligodendrocyte population without significantly affecting PDGFRα+ OPCs . BrdU birth-dating experiments further demonstrate that OPALIN deletion impairs the differentiation process, as evidenced by a decreased ratio of BrdU+/CC1+ cells to CC1+ cells in OPALIN conditional knockout mice . The mechanisms controlling this developmental regulation appear to involve Sox10-mediated transcriptional activation, as OPALIN re-expression restores Sox10+ cell numbers and protein levels in knockout mice .

How does the LGI1-OPALIN interaction mechanistically promote oligodendrocyte differentiation?

The LGI1-OPALIN interaction serves as a crucial signaling pathway promoting oligodendrocyte differentiation through multiple downstream mechanisms:

  • Direct Binding: Immunoprecipitation experiments have confirmed that LGI1 directly binds to OPALIN. This was demonstrated both in mouse brain lysates, where anti-OPALIN antibodies successfully pulled down LGI1 and vice versa, and in heterologous expression systems where LGI1-3×FLAG effectively bound to OPALIN-HA-expressing HEK293T cells .

  • mTOR Pathway Activation: The LGI1-OPALIN interaction appears to activate the mTOR signaling pathway, which is critical for oligodendrocyte differentiation and myelination. Re-expression of wild-type OPALIN, but not binding-deficient mutants (OPALIN_K23A/D26A), restored mTOR signaling activity in knockout mice .

  • Sox10 Expression Regulation: OPALIN appears to regulate Sox10 expression, a key transcription factor for oligodendrocyte development. OPALIN deletion reduced Sox10+ cell numbers, while re-expression of wild-type OPALIN, but not binding-deficient mutants, restored these numbers .

These findings collectively suggest that the LGI1-OPALIN interaction initiates signaling cascades that ultimately enhance transcriptional programs necessary for oligodendrocyte differentiation.

What are the key experimental models for studying OPALIN function in myelination?

Several experimental models have proven valuable for investigating OPALIN's role in myelination:

Model SystemApplicationsKey FindingsCitation
Conditional knockout miceLoss-of-function studiesOPALIN deletion reduces mature oligodendrocytes and causes white matter abnormalities
AAV-mediated re-expressionRescue experimentsWild-type OPALIN, but not binding-deficient mutants, rescues myelination defects
BrdU birth-datingCell differentiation trackingOPALIN is required for OPC-to-OL differentiation
MRI with fractional anisotropy (FA)White matter integrity assessmentOPALIN deletion reduces FA values, indicating compromised white matter structure

For researchers beginning work on OPALIN function, conditional knockout models followed by rescue experiments with AAV-mediated expression provide the most comprehensive insights into protein function. The combination of cellular, molecular, and imaging approaches offers a multifaceted view of how OPALIN affects oligodendrocyte development and myelination .

How do OPALIN mutations affect oligodendrocyte differentiation and myelination?

Studies on OPALIN mutations provide critical insights into its functional domains. The OPALIN_K23A/D26A mutant, which fails to bind LGI1, cannot rescue the phenotypes observed in OPALIN knockout mice, including:

  • White matter abnormalities: Fractional anisotropy values in MRI scans remain low when mutant OPALIN is expressed, indicating persistent white matter defects .

  • Reduced oligodendrocyte numbers: The numbers of MBP+ fibers and CC1+ cells remain significantly lower compared to rescue with wild-type OPALIN .

  • Decreased myelin protein expression: Protein levels of myelin markers like MBP and CNPase are not restored with mutant OPALIN expression .

  • Impaired Sox10+ cell populations: Sox10+ cell numbers and Sox10 protein levels remain reduced with mutant OPALIN expression .

These findings demonstrate that the LGI1-binding interface of OPALIN, particularly residues K23 and D26, is essential for its function in promoting oligodendrocyte differentiation and myelination.

What are the optimal conditions for storing and handling recombinant Pongo abelii OPALIN?

For optimal stability and activity, recombinant Pongo abelii OPALIN should be stored according to the following guidelines:

  • Short-term storage: Store working aliquots at 4°C for up to one week .

  • Standard storage: Store at -20°C in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein .

  • Long-term storage: For extended preservation, store at -80°C .

  • Avoid freeze-thaw cycles: Repeated freezing and thawing is not recommended as it can reduce protein activity .

When handling the protein, it's advisable to:

  • Prepare small working aliquots to minimize freeze-thaw cycles

  • Allow the protein to equilibrate to room temperature before opening the tube

  • Use sterile techniques when handling the protein to prevent contamination

  • Consider adding protease inhibitors when using the protein in complex biological matrices

What experimental approaches can be used to study the LGI1-OPALIN interaction?

Multiple complementary approaches can be employed to investigate the LGI1-OPALIN interaction:

  • Affinity Chromatography and Mass Spectrometry: This approach was successfully used to initially identify OPALIN as an LGI1-binding partner. Recombinant LGI1 protein fused to a 3×FLAG tag was purified and used for affinity chromatography with mouse brain lysates, followed by mass spectrometry to identify binding partners .

  • Co-immunoprecipitation: Both endogenous and overexpressed proteins can be analyzed using immunoprecipitation. Anti-OPALIN antibodies can pull down LGI1 from brain lysates, and anti-LGI1 antibodies can pull down OPALIN .

  • Heterologous Expression Systems: Expressing OPALIN in HEK293T cells and incubating with tagged LGI1 allows for visualization of binding. FLAG signals were detected surrounding OPALIN-positive but not OPALIN-negative cells, confirming specific binding .

  • Mutagenesis Studies: Site-directed mutagenesis of key residues (e.g., K23A/D26A in OPALIN) can identify critical binding interfaces .

  • In vivo Rescue Experiments: AAV-mediated expression of wild-type versus mutant OPALIN in knockout animals can confirm the functional relevance of specific binding interactions .

These methods collectively provide strong evidence for direct and functionally significant protein-protein interactions.

What controls should be included when performing experiments with recombinant OPALIN?

When conducting experiments with recombinant OPALIN, the following controls should be included:

  • Negative Controls:

    • Buffer-only controls to account for buffer effects

    • Irrelevant proteins of similar size and structure to control for non-specific effects

    • For binding studies: OPALIN-negative cells or OPALIN mutants with disrupted binding interfaces (e.g., OPALIN_K23A/D26A)

  • Positive Controls:

    • Known OPALIN-interacting proteins such as LGI1

    • For functional studies: comparison with wild-type OPALIN in rescue experiments

  • Validation Controls:

    • Western blot confirmation of protein expression and integrity

    • Immunofluorescence to verify proper subcellular localization (membrane expression for OPALIN)

    • Dose-response assessments to ensure observed effects are concentration-dependent

  • Technical Controls:

    • Fresh versus frozen protein comparisons to assess stability

    • Multiple batches of recombinant protein to ensure reproducibility

    • Species-matched controls when studying cross-species effects

Incorporating these controls ensures experimental rigor and facilitates the interpretation of results when working with recombinant OPALIN.

What evolutionary insights can be gained from studying OPALIN in Pongo abelii?

Studying OPALIN in Pongo abelii (Sumatran orangutan) offers valuable evolutionary perspectives on myelination:

  • Primate-specific Adaptations: Orangutans are among the most distantly related great apes to humans , making them valuable for understanding primate-specific adaptations in myelin-related proteins. Comparing OPALIN structure and function between Pongo abelii, other great apes, and humans could reveal evolutionary changes associated with advanced cognitive abilities.

  • Ecological Correlations: Sumatran orangutans inhabit dense tropical forests and display remarkable cognitive abilities, including tool use and social learning . The role of OPALIN in myelination might correlate with these cognitive traits, providing insights into brain evolution.

  • Conservation Biology: With only about 4,000 Sumatran orangutans remaining in the wild , understanding their unique biology, including myelin-related proteins like OPALIN, could contribute to conservation efforts by highlighting the biological uniqueness of this endangered species.

  • Comparative Neurobiology: Orangutans have distinct neural adaptations that allow them to create mental maps of their forest habitats . Studying OPALIN's role in myelination could provide insights into the neural substrates of these specialized cognitive abilities.

Research on Pongo abelii OPALIN thus contributes not only to understanding basic myelination mechanisms but also to broader questions about primate brain evolution and adaptation.

What are the major challenges in studying OPALIN's role in oligodendrocyte development?

Researchers investigating OPALIN face several significant challenges:

  • Specificity of Cellular Effects: Distinguishing between direct effects of OPALIN on oligodendrocyte differentiation versus secondary effects on other cell types remains challenging. Conditional knockout models using cell-type-specific promoters help address this, as demonstrated in studies using CNP-Cre to specifically delete OPALIN in oligodendrocytes .

  • Temporal Dynamics: OPALIN's effects may vary throughout development. BrdU birth-dating experiments reveal its importance in the differentiation process , but capturing the complete temporal profile requires multiple time-point analyses.

  • Downstream Signaling Complexity: While OPALIN affects mTOR signaling and Sox10 expression , the complete signaling network remains to be fully characterized. Phosphoproteomic and transcriptomic approaches would help elucidate these pathways.

  • Functional Redundancy: Potential compensation by other myelin-related proteins may mask phenotypes in knockout models. Acute knockout or degradation approaches could help minimize compensatory mechanisms.

  • Translating In Vitro Findings: Bridging the gap between cellular studies and in vivo myelination requires complementary approaches. The combination of primary culture studies with in vivo imaging techniques like MRI with fractional anisotropy provides a more comprehensive picture .

How can recombinant OPALIN be used to study demyelinating diseases?

Recombinant OPALIN offers several applications for investigating demyelinating diseases:

  • Therapeutic Potential Assessment: Since OPALIN promotes oligodendrocyte differentiation , recombinant OPALIN or OPALIN-mimetic compounds could potentially enhance remyelination in diseases like multiple sclerosis. In vitro assays using recombinant protein can serve as preliminary screens for such approaches.

  • Mechanistic Studies: Recombinant OPALIN can be used to investigate whether the LGI1-OPALIN interaction is disrupted in disease states. Comparing binding efficiency using samples from healthy versus diseased tissue could reveal disease-specific alterations.

  • Biomarker Development: Antibodies against OPALIN could be used to assess oligodendrocyte health in pathological samples. Changes in OPALIN expression or localization might serve as indicators of disease progression or treatment efficacy.

  • In Vitro Disease Modeling: Recombinant OPALIN can be used in co-culture systems with neurons and oligodendrocytes to study myelination in controlled environments that model disease conditions (inflammation, oxidative stress, etc.).

  • Screening Platform: A system using recombinant OPALIN and its binding partners could serve as a screening platform for compounds that enhance OPALIN function or the LGI1-OPALIN interaction, potentially identifying novel therapeutics for demyelinating disorders.

What are the key considerations when designing experiments to study OPALIN's interaction with LGI1?

When investigating the OPALIN-LGI1 interaction, researchers should consider:

  • Binding Interface Characterization:

    • Site-directed mutagenesis has identified K23 and D26 as critical residues in OPALIN for LGI1 binding

    • Additional mutagenesis experiments should systematically map the complete binding interface

    • Structural biology approaches (X-ray crystallography, cryo-EM) would provide detailed interaction information

  • Functional Validation:

    • Rescue experiments with wild-type versus mutant OPALIN effectively validate functional significance

    • Consider using graded mutations with varying binding affinities to establish dose-response relationships

    • Evaluate multiple functional readouts (differentiation, myelination, signaling) to comprehensively assess impact

  • Kinetic Parameters:

    • Determine binding constants (Kd, kon, koff) using surface plasmon resonance or bio-layer interferometry

    • Investigate how binding kinetics correlate with functional outcomes

  • Competitive Interactions:

    • Test whether other proteins compete with LGI1 for OPALIN binding

    • Investigate whether OPALIN competes with other LGI1 receptors like ADAM22/23

  • Experimental Conditions:

    • Consider the impact of pH, temperature, and ionic strength on binding

    • Evaluate binding in different cellular compartments and membrane microdomains

    • Test whether post-translational modifications affect the interaction

By addressing these considerations, researchers can gain deeper insights into the molecular mechanisms underlying OPALIN's role in oligodendrocyte biology and myelination.

What are the promising new techniques for studying OPALIN function in vivo?

Several cutting-edge techniques show promise for advancing OPALIN research:

  • CRISPR-Based Approaches:

    • CRISPR activation (CRISPRa) or interference (CRISPRi) for temporal control of OPALIN expression

    • Base editing or prime editing for introducing specific mutations to study structure-function relationships

    • In vivo CRISPR screens to identify genetic modifiers of OPALIN function

  • Advanced Imaging:

    • Live imaging of OPALIN-GFP fusion proteins to track dynamics during oligodendrocyte differentiation

    • Super-resolution microscopy to visualize OPALIN localization at the nanoscale

    • Expansion microscopy to better resolve OPALIN distribution in myelin structures

  • Single-Cell Technologies:

    • Single-cell RNA-seq to profile transcriptional changes in response to OPALIN manipulation

    • Single-cell proteomics to identify cell type-specific signaling pathways downstream of OPALIN

    • Spatial transcriptomics to correlate OPALIN expression with local tissue environment

  • Organoid Models:

    • Brain organoids containing oligodendrocytes to study OPALIN in a more physiologically relevant context

    • Patient-derived organoids to investigate OPALIN in human disease contexts

These emerging techniques will enable more precise manipulation and visualization of OPALIN function in increasingly complex and physiologically relevant models.

How might understanding OPALIN biology contribute to therapeutic approaches for myelin disorders?

Understanding OPALIN biology offers several promising therapeutic avenues:

  • Remyelination Promotion:

    • Since OPALIN is essential for oligodendrocyte differentiation , enhancing its expression or function could promote remyelination in diseases like multiple sclerosis

    • Small molecules that enhance the LGI1-OPALIN interaction could serve as remyelination-promoting therapeutics

  • Biomarker Development:

    • Changes in OPALIN expression or in soluble OPALIN fragments might serve as biomarkers for myelin disorders

    • Monitoring OPALIN levels could help track disease progression or treatment response

  • Gene Therapy Approaches:

    • AAV-mediated OPALIN delivery has shown efficacy in rescuing knockout phenotypes in mice , suggesting potential for gene therapy

    • Similar approaches could be developed for human myelin disorders with OPALIN dysfunction

  • Targeted Drug Delivery:

    • OPALIN-targeted nanoparticles could deliver therapeutics specifically to oligodendrocytes

    • Such approaches could increase efficacy while reducing off-target effects

  • Combinatorial Therapies:

    • OPALIN-enhancing treatments could be combined with immunomodulatory or neuroprotective therapies for synergistic effects

    • Understanding how OPALIN interacts with other myelin-related pathways could inform optimal combination strategies

As research on OPALIN continues to advance, these therapeutic applications will likely become increasingly feasible and refined.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.