Recombinant Pongo abelii Palmitoyltransferase ZDHHC5 (ZDHHC5)

Shipped with Ice Packs
In Stock

Description

Biochemical Characterization

ZDHHC5 belongs to the DHHC family of palmitoyltransferases that mediate S-acylation, a reversible lipid modification critical for membrane trafficking and protein stability . Key features include:

PropertyDetails
Catalytic DomainContains a DHHC-CRD motif essential for palmitoyltransferase activity .
Expression SystemTypically produced in E. coli or yeast for recombinant studies .
Structural MotifsJuxtamembrane amphipathic helix for substrate recruitment .
Post-Translational ModsAutopalmitoylation at C236/237 regulates membrane localization .

Cardiac Physiology

ZDHHC5 expression correlates with cardiac hypertrophy and heart failure (HF), though substrate palmitoylation (e.g., NCX1, PLM) doesn’t always align with enzyme levels . In HF models:

  • Pig HF: Reduced ZDHHC5 palmitoylation (-40%, p < 0.05) .

  • Human HF: Increased NCX1 palmitoylation (+25%, p < 0.01) despite variable ZDHHC5 expression .

Synaptic and Metabolic Regulation

  • Facilitates AMPAR stabilization via δ-catenin palmitoylation, enhancing synaptic plasticity .

  • Modulates fatty acid uptake by palmitoylating CD36 .

  • In hypothalamic microglia, ZDHHC5-mediated PKCδ palmitoylation drives neuroinflammation, inhibited by artemether (ART) .

Substrate Recruitment Mechanism

ZDHHC5 activity depends on interaction partners like the Na⁺/K⁺ ATPase:

Interaction PartnerFunctional Outcome
Na⁺/K⁺ ATPase α-subunitRecruits phospholemman (PLM) for palmitoylation, regulated by C-tail modifications .
ZDHHC20Palmitoylates ZDHHC5 at C236/237, enhancing Na⁺/K⁺ ATPase binding .
GOLGA7Stabilizes ZDHHC5 membrane localization via C-terminal interactions .

Research Implications

  • Therapeutic Targeting: Disrupting ZDHHC5-Na⁺/K⁺ ATPase interaction with synthetic peptides reduces PLM palmitoylation, suggesting HF treatment avenues .

  • Disease Models: ZDHHC5 knockdown in microglia attenuates neuroinflammation (p < 0.001 for TNF-α/IL-6 reduction) .

  • Technical Limitations: Species-specific variations (e.g., Pongo vs. Homo) necessitate cautious extrapolation of mechanistic data .

Outstanding Questions

  1. How do Pongo abelii ZDHHC5 structural differences impact substrate specificity compared to human isoforms?

  2. What regulatory pathways control ZDHHC5 expression in non-cardiac tissues?

  3. Can ZDHHC5 inhibitors be optimized for clinical use without off-target effects?

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you have a preferred tag type, please inform us, and we will prioritize its inclusion.
Synonyms
ZDHHC5; Palmitoyltransferase ZDHHC5; Zinc finger DHHC domain-containing protein 5; DHHC-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-715
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MPAESGKRFKPSKYVPVSAAAIFLVGATTLFFAFTCPGLSLYVSPAVPIYNAIMFLFVLA NFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHC SVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSG VRTADTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNV SRVLCSSPAPRYLGRPKKEKTIVIRPPFLRPEVSDGQITVKIMDNGIQGELRRTKSKGSL EITESQSADAEPPPPPKPDLSRYTGLRTHLGLATNEDSSLLAKDSPPTPTMYKYRPGYSS SSTSAAMPHSSSAKLSRGDSLKEPTSIAESSRHPSYRSEPSLEPESFRSPTFGKSFHFDP LSSGSRSSSLKSAQGTGFELGQLQSIRSEGTTSTSYKSLANQTRNGSLSYDSLLTPSDSP DFESVQAGPEPDPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHI VASLQEREKLLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLGKTPL GRPAVPRFGKPDGLRGRGVGSPEPGPTAPYLGRSMSYSSQKAQPGVSETEEVALQPLLTP KDEVQLKTAYSKSNGQPKSLGSASPGPGQPPLSSPTRGGVKKVSGVGGTTYEISV
Uniprot No.

Target Background

Function
Palmitoyltransferase is an enzyme that catalyzes the addition of palmitate to various protein substrates. This process is involved in a wide range of cellular functions. ZDHHC5, a specific palmitoyltransferase, plays a role in the palmitoylation of the G-protein coupled receptor SSTR5 and FLOT2.
Database Links
Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ZDHHC5 and what is its primary function in cellular physiology?

ZDHHC5 (zinc finger DHHC-type containing 5) is a palmitoyl acyltransferase (PAT) that catalyzes S-palmitoylation, a post-translational lipid modification that adds medium-chain fatty acids, particularly palmitate (C16), to cytoplasmic cysteines of substrate proteins. Unlike most ZDHHC family members that localize to the endoplasmic reticulum and Golgi apparatus, ZDHHC5 distinctively localizes to the endosomal system, allowing it to modify a unique set of substrates and regulate their trafficking, turnover rate, and function . ZDHHC5 plays critical roles in multiple physiological processes including cardiac function, neuronal development, and immune responses, with substantial evidence indicating its dysregulation contributes to pathological conditions including heart failure and cancer progression .

What expression systems are most effective for producing recombinant ZDHHC5 for research applications?

For recombinant ZDHHC5 production, multiple expression systems have been successfully employed with varying advantages:

E. coli expression systems:

  • Typically used for expressing specific domains rather than the full-length protein

  • Expression region 527-637aa has been successfully produced in E. coli

  • Advantages include high yield and cost-effectiveness

Yeast expression systems:

  • Particularly effective for producing functional ZDHHC5 with proper post-translational modifications

  • Can incorporate N-terminal 10xHis-tags and C-terminal Myc-tags for purification and detection

  • Yields recombinant protein with greater than 85% purity as determined by SDS-PAGE

Mammalian expression systems:

  • Optimal for functional studies where native folding and modifications are critical

  • Adenoviral vectors expressing HA-tagged ZDHHC5 and catalytically inactive ZDHHC5 (ZDHHS5) have been engineered for controlled expression in primary cells

  • pCMV6-Entry vector has been used for ZDHHC5 expression in mammalian cells with neomycin selection

How can researchers verify the expression and activity of recombinant ZDHHC5?

Verification of recombinant ZDHHC5 expression and activity requires a multi-faceted approach:

Expression verification methods:

  • Western blotting using specific antibodies (e.g., 21324-1-AP antibody at 1:500-1:2000 dilution)

  • Immunofluorescence microscopy to confirm subcellular localization (1:200-1:800 dilution)

  • Flow cytometry for quantitative assessment (0.40 μg per 10^6 cells)

Activity verification methods:

  • Acyl-PEG Exchange (APE) assay: Measures palmitoylation of ZDHHC5 substrates by detecting mass shifts after PEG-maleimide coupling to formerly palmitoylated cysteines

  • Metabolic incorporation assay: Uses alkyne-palmitate analogs followed by click chemistry to detect palmitoylated proteins

  • Functional substrate assays: Monitoring palmitoylation status of known ZDHHC5 substrates such as NCX1, PLM, or FAK before and after ZDHHC5 expression

What methods are most effective for detecting ZDHHC5-mediated protein palmitoylation?

Several complementary methods have been established for detecting and quantifying ZDHHC5-mediated protein palmitoylation:

Acyl-Biotin Exchange (ABE):

  • Involves replacement of thioester-linked palmitate with biotin followed by streptavidin pulldown

  • Can be used to identify palmitoylated proteins on a proteome-wide scale

  • Provides a palmitoylation fraction that can be normalized to total protein levels

Metabolic labeling:

  • Utilizes alkyne-palmitate analogs that can be coupled to detection tags via click chemistry

  • Allows for pulse-chase experiments to determine palmitoylation dynamics

  • Applied successfully to detect FAK palmitoylation by ZDHHC5 in glioblastoma cells

Acyl-PEG Exchange (APE):

  • Detects palmitoylation through mass shifts on gels after PEG-maleimide coupling

  • Provides quantifiable results on specific protein palmitoylation status

  • Successfully used to assess FAK palmitoylation in U251 and T98G cell lines

Site-directed mutagenesis approach:

  • Systematic mutation of cysteine residues to identify specific palmitoylation sites

  • Complemented with functional assays to determine the impact of palmitoylation on protein function

  • Identified C456 as a key palmitoylation site of FAK by ZDHHC5

How can researchers accurately assess ZDHHC5 localization in cellular models?

Accurate assessment of ZDHHC5 localization requires multi-method validation approaches:

Confocal microscopy:

  • Use of HA-tagged or fluorescently labeled ZDHHC5 constructs

  • Has revealed ZDHHC5 localization in intercalated discs, cell surface, and perinuclear membrane in cardiomyocytes

  • Recommended antibody dilutions for immunofluorescence: 1:200-1:800

Subcellular fractionation:

  • Sucrose gradient fractionation has demonstrated that ZDHHC5 localizes to buoyant membranes alongside Caveolin-3

  • Differential centrifugation can separate membrane-bound from cytosolic ZDHHC5

Proximity labeling approaches:

  • BioID or APEX2-based approaches to identify proteins in proximity to ZDHHC5

  • Has identified DHHC20 as an interactor and palmitoylating enzyme of ZDHHC5

Co-localization studies:

  • Dual labeling with markers for specific cellular compartments (plasma membrane, endosomes, Golgi)

  • Co-immunoprecipitation (Co-IP) to identify interacting partners that contribute to localization

What are the optimal approaches to study ZDHHC5 substrate specificity?

Understanding ZDHHC5 substrate specificity requires specialized methodologies:

Substrate prediction tools:

  • Computational analysis of potential palmitoylation sites using algorithms like CSS-Palm

  • Molecular modeling of substrate binding to ZDHHC5's active site and substrate binding domain

Substrate validation methods:

  • In vitro palmitoylation assays: Purified ZDHHC5 incubated with candidate substrates and palmitoyl-CoA

  • Cell-based overexpression and silencing: Manipulating ZDHHC5 levels and measuring changes in substrate palmitoylation

  • Proximity-based proteomics: BioID or APEX2-based approaches to identify proteins that come into close proximity with ZDHHC5

Structure-function analysis:

  • Based on computational modeling, the binding pocket of ZDHHC5's substrate binding domain includes His132, Cys134, Pro135, Trp136, Phe196, Pro199, Leu203, Phe206, and Thr217

  • Site-directed mutagenesis of these residues can validate their role in substrate recognition

How does ZDHHC5 expression change in cardiac hypertrophy and heart failure?

Research has revealed complex, dynamic changes in ZDHHC5 expression across different cardiac pathological states:

Cardiac hypertrophy:

  • ZDHHC5 expression is significantly elevated in left ventricular hypertrophy (LVH)

  • This increase is an early event in the onset of LVH, suggesting potential involvement in disease initiation

Heart failure progression:

  • Expression patterns differ between animal models and human samples:

    • Rabbit MI model: ZDHHC5 expression unchanged

    • Pig ischemia/reperfusion model: ZDHHC5 expression modestly reduced

    • Human ischemic heart failure: ZDHHC5 expression significantly reduced

Comparative expression data:

ModelConditionZDHHC5 Expression ChangeNCX1 PalmitoylationPLM Palmitoylation
AnimalLVHIncreasedDecreasedUnchanged
RabbitMI-induced HFUnchangedDecreasedUnchanged
PigIschemia/reperfusionModestly reducedDecreasedUnchanged
HumanIschemic HFSignificantly reducedIncreasedUnchanged

This data highlights the discordance between ZDHHC5 expression levels and substrate palmitoylation status in heart disease .

What is the relationship between ZDHHC5 expression and substrate palmitoylation in cardiac tissue?

A paradoxical relationship exists between ZDHHC5 expression and substrate palmitoylation in cardiac tissue:

Expression-palmitoylation discordance:

  • Despite increased ZDHHC5 expression in LVH, substrate palmitoylation patterns are not consistently elevated

  • NCX1 palmitoylation is significantly reduced in animal models despite unchanged or increased ZDHHC5 expression

  • Human HF samples show increased NCX1 palmitoylation despite reduced ZDHHC5 expression

Potential mechanisms explaining discordance:

  • ZDHHC5 post-translational modifications: ZDHHC5 itself is palmitoylated on its C-terminal tail, which affects its activity and substrate recruitment

  • Regulatory interactions: Interaction with GOLGA7B controls ZDHHC5 membrane localization

  • Substrate availability: Changes in substrate expression or localization may affect palmitoylation independently of ZDHHC5 levels

  • Other PAT involvement: Other ZDHHC family members may compensate for ZDHHC5 changes

Research has shown "no relationship between ZDHHC5 expression levels and substrate palmitoylation levels can be detected" in human HF and organ donor samples , suggesting complex regulatory mechanisms beyond simple expression levels.

How does overexpression of ZDHHC5 affect cardiomyocyte function?

Studies examining the functional impact of ZDHHC5 overexpression in cardiomyocytes have revealed:

Contractile function:

  • Adenoviral overexpression of ZDHHC5 or catalytically inactive ZDHHC5 (ZDHHC5) in adult rabbit ventricular cardiomyocytes had no effect on:

    • Contractile force (sarcomere shortening)

    • Other parameters of contractility

Subcellular localization:

  • Confocal microscopy of HA-tagged ZDHHC5 revealed localization in:

    • Intercalated discs

    • Cell surface

    • Perinuclear membrane

Substrate palmitoylation:

  • Despite ZDHHC5 overexpression, there was no significant change in palmitoylation of key substrates:

    • NCX1 (sodium-calcium exchanger)

    • PLM (phospholemman)

These findings suggest that ZDHHC5 expression alone is insufficient to drive changes in substrate palmitoylation or contractile function, indicating additional regulatory mechanisms control ZDHHC5 activity in cardiomyocytes.

What role does ZDHHC5 play in anthrax toxin cellular entry?

ZDHHC5 has been identified as a critical component in anthrax toxin entry into host cells:

Mechanism of involvement:

  • ZDHHC5 palmitoylates proprotein convertases (PCs) including Furin

  • These PCs are essential for cleaving protective antigen (PA), a component of anthrax toxin

  • Palmitoylation affects the localization of PCs in specific membrane microdomains

Experimental evidence:

  • Silencing ZDHHC5 significantly impacts the cleavage of PC biosensors at multiple cellular locations:

    • Late endosomes

    • GPI-rich domains

    • Plasma membrane (though to a lesser extent)

Specific pathway details:

  • Anthrax toxin enters cells using receptors CMG2 and TEM8

  • Upon binding, PA is cleaved by PCs

  • This cleavage allows PA oligomerization and binding of lethal factor (LF) or edema factor (EF)

  • The complex is internalized, and the toxin components are translocated across the endosomal membrane

  • ZDHHC5 facilitates this process by ensuring proper localization of PCs through palmitoylation

This research highlights how ZDHHC5-mediated palmitoylation can affect host-pathogen interactions by controlling the microenvironment where toxin processing occurs.

How can researchers effectively inhibit ZDHHC5 function to study its role in disease processes?

Multiple approaches have been developed to inhibit ZDHHC5 function for research applications:

Genetic approaches:

  • siRNA knockdown: Successfully used to reduce ZDHHC5 expression in cell models (e.g., Panc-1 and Mia PaCa-2 cell lines)

  • Stable ZDHHC5-knockdown cell lines: Generated using shRNA or CRISPR-Cas9, validated by RT-qPCR and Western blot

  • Catalytically inactive mutants: ZDHHC5 with the active site cysteine mutated (ZDHHS5) serves as a dominant negative

Pharmacological inhibition:

  • 2-bromopalmitate: A general palmitoylation inhibitor used to assess the impact of palmitoylation on protein function and localization

  • Lomitapide: Identified through computational screening as a potent ZDHHC5 antagonist (Kd = 509 nM)

    • Binds to the substrate binding domain of ZDHHC5

    • Predicted binding pocket consists of His132, Cys134, Pro135, Trp136, Phe196, Pro199, Leu203, Phe206, and Thr217

    • Pharmacological blockade with Lomitapide attenuates cancer cell growth and proliferation

Validation of inhibition:

  • Monitor changes in palmitoylation of known ZDHHC5 substrates (NCX1, PLM, FAK) using APE assay

  • Assess cellular phenotypes associated with ZDHHC5 function, including protein localization and downstream signaling

How does ZDHHC5 contribute to cancer cell proliferation and invasion?

Recent research has uncovered important roles for ZDHHC5 in cancer progression:

Pancreatic cancer:

  • Single-cell transcriptome sequencing identified ZDHHC5 as a potential target for anti-proliferation

  • ZDHHC5 knockdown resulted in dramatic antitumor effects

  • ZDHHC5 expression is higher in cancer cells compared to HPDE (normal pancreatic ductal epithelial) cells

Glioblastoma:

  • ZDHHC5 mediates S-palmitoylation of focal adhesion kinase (FAK) at C456

  • This palmitoylation is critical for:

    • FAK membrane localization and activation

    • Cell proliferation and invasion

    • Epithelial-mesenchymal transition (EMT)

Experimental evidence:

  • Silencing ZDHHC5 significantly decreases cell proliferation in pancreatic cancer cell lines

  • Knockdown of ZDHHC5 abrogates S-palmitoylation and membrane distribution of FAK

  • In vivo studies using intracranial GBM xenografts demonstrated that silencing ZDHHC5 impairs tumor growth

These findings suggest the ZDHHC5/FAK axis as a promising therapeutic target in multiple cancer types.

What methodologies are most effective for studying ZDHHC5 in cancer models?

Researchers investigating ZDHHC5 in cancer contexts employ several specialized methodologies:

In vitro methods:

  • Cell proliferation assays: CCK8 assays, colony formation assays to assess impact of ZDHHC5 manipulation

  • Invasion assays: Transwell assays to evaluate cell migration and invasion capabilities

  • Palmitoylation detection: APE assay and metabolic incorporation assay to determine substrate palmitoylation status

In vivo approaches:

  • Xenograft tumor models: Intracranial GBM xenografts with ZDHHC5 knockdown to assess tumor growth

  • Patient-derived xenografts: More accurately represent tumor heterogeneity and microenvironment

Molecular screening approaches:

  • Single-cell transcriptome sequencing: To identify ZDHHC5 as a potential target in patient samples

  • Virtual screening: Molecular docking of FDA-approved drugs to ZDHHC5's substrate binding domain identified Lomitapide as a potential inhibitor

Binding assays:

  • Determination of binding affinities: Measurement of Kd values between candidate inhibitors and ZDHHC5's substrate binding domain

  • Structure-activity relationship studies: To optimize inhibitor binding and specificity

How do post-translational modifications of ZDHHC5 itself regulate its activity?

ZDHHC5 undergoes several post-translational modifications that regulate its function:

Self-palmitoylation:

  • ZDHHC5 undergoes autopalmitoylation at its active site cysteine, which is essential for its enzymatic activity

  • Additionally, ZDHHC5 is palmitoylated at sites in its C-terminal tail

  • This C-terminal palmitoylation occurs in an amphipathic helix that contains binding sites for the Na+/K+ ATPase and GOLGA7B

Regulation by other PATs:

  • ZDHHC20 has been identified as an interactor and palmitoylating enzyme of ZDHHC5

  • Palmitoylation of ZDHHC5's C-terminal tail in response to adrenergic stimulation is required for its stabilization at the plasma membrane

Palmitoylation status changes in disease:

  • ZDHHC5 palmitoylation is altered in heart failure models:

    • Significantly reduced in the pig model

    • Modestly increased (though not significantly) in human HF samples

  • These changes parallel alterations in NCX1 palmitoylation, suggesting coordinated regulation

Functional consequences:

  • Changes in ZDHHC5 palmitoylation affect:

    • Membrane localization

    • Protein-protein interactions

    • Substrate recruitment and palmitoylation efficiency

Understanding these regulatory mechanisms may provide new therapeutic opportunities for modulating ZDHHC5 activity in disease contexts.

What explains the discordance between ZDHHC5 expression and substrate palmitoylation in disease models?

The puzzling observation that ZDHHC5 expression poorly correlates with substrate palmitoylation can be explained by several sophisticated mechanisms:

Complex regulatory network:

  • Palmitoylation of ZDHHC5 itself: Changes in ZDHHC5 palmitoylation status affect its activity and localization independently of expression levels

  • Accessory proteins: GOLGA7B regulates ZDHHC5 cell surface expression and activity

  • Substrate co-localization: Changes in the spatial distribution of ZDHHC5 relative to its substrates may alter palmitoylation efficiency

Substrate-specific factors:

  • Competing modifications: Other post-translational modifications may compete with palmitoylation at substrate cysteine residues

  • Substrate conformation: Changes in protein folding or complex formation may alter accessibility of palmitoylation sites

  • Depalmitoylation enzymes: Altered activity of acyl-protein thioesterases that remove palmitate groups

Metabolic considerations:

  • Palmitate availability: Levels of palmitate or palmitoyl-CoA may limit palmitoylation independently of ZDHHC5 expression

  • Acyl-CoA synthetase activity: The availability of the acyl-CoA substrate, synthesized by ACSLs, may be rate-limiting

This complexity suggests that therapeutic approaches targeting the ZDHHC5 pathway should consider the entire regulatory network rather than simply modulating ZDHHC5 expression levels.

What emerging technologies might advance our understanding of ZDHHC5 function and regulation?

Several cutting-edge technologies show promise for deepening our understanding of ZDHHC5:

Advanced imaging approaches:

  • Super-resolution microscopy: Techniques like STORM or PALM can reveal nanoscale organization of ZDHHC5 and its substrates in membrane microdomains

  • Live-cell palmitoylation sensors: Genetically encoded biosensors that report on real-time palmitoylation dynamics

Proteomics innovations:

  • Targeted proteomics: Selective Reaction Monitoring (SRM) or Parallel Reaction Monitoring (PRM) for accurate quantification of ZDHHC5 and its substrates

  • Palmitoyl-proteomics: Click chemistry-based enrichment methods coupled with mass spectrometry to identify novel ZDHHC5 substrates

Structural biology approaches:

  • Cryo-EM analysis: To determine the full-length structure of ZDHHC5 in different conformational states

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To map dynamic regions and binding interfaces

Genetic engineering tools:

  • CRISPR base editing: For introducing specific mutations in ZDHHC5 or substrate palmitoylation sites

  • Optogenetic control of ZDHHC5: Light-inducible systems to control ZDHHC5 activity with spatial and temporal precision

Computational methods:

  • Machine learning algorithms: To predict palmitoylation sites and substrate specificity determinants

  • Molecular dynamics simulations: To understand the structural basis of ZDHHC5-substrate interactions and inhibitor binding

These emerging technologies promise to resolve current contradictions in the field and identify new therapeutic opportunities targeting the ZDHHC5 pathway.

What are the critical considerations for designing expression constructs for recombinant ZDHHC5?

Successful production of functional recombinant ZDHHC5 requires careful construct design:

Tag selection and placement:

  • N-terminal tags (6xHis, 10xHis) facilitate purification while minimizing interference with the C-terminal regulatory domain

  • C-terminal tags (Myc, DDK) enable detection without disrupting the N-terminal membrane topology

  • HA tags have been successfully used for immunofluorescence localization studies

Expression region considerations:

  • Full-length expression (715 amino acids, 78 kDa) preserves all functional domains but can present solubility challenges

  • Truncated constructs may be more stable:

    • Expression region 527-637aa has been successfully produced

    • Catalytic DHHC domain expression maintains enzymatic activity for in vitro assays

Vector selection:

  • pCMV6-Entry vector with kanamycin (25 μg/mL) for E. coli selection and neomycin for mammalian cell selection has proven effective

  • Viral vectors (adenoviral) allow for dose-dependent expression in primary cells like cardiomyocytes

Mutation strategies:

  • Catalytically inactive mutant (ZDHHS5) where the active site cysteine is replaced with serine serves as an important control

  • Site-directed mutagenesis of palmitoylation sites in the C-terminal domain to study autoregulation

What purification strategies yield highest activity of recombinant ZDHHC5?

Optimizing purification protocols is essential for maintaining ZDHHC5 enzymatic activity:

Membrane protein solubilization:

  • ZDHHC5 is a multi-pass membrane protein requiring careful solubilization

  • Mild detergents (0.5-1% DDM, 1% CHAPS) preserve structure and activity better than harsher detergents (SDS, Triton X-100)

  • Detergent screening is recommended to identify optimal conditions for each expression system

Affinity purification:

  • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

  • Anti-tag antibody affinity chromatography for Myc or DDK-tagged versions

Activity preservation:

  • Addition of lipids or lipid-like compounds during purification helps maintain native conformation

  • Inclusion of reducing agents (DTT, TCEP) prevents oxidation of catalytic cysteine

  • Glycerol (10-20%) in storage buffer enhances stability

Quality control:

  • SDS-PAGE analysis shows greater than 85% purity for properly optimized protocols

  • Western blot verification using antibodies at recommended dilutions (1:500-1:2000)

  • Activity assays to confirm enzymatic function post-purification

These considerations enable production of high-quality recombinant ZDHHC5 protein suitable for biochemical and structural studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.