Recombinant Pongo abelii Palmitoyltransferase ZDHHC9 (ZDHHC9)

Shipped with Ice Packs
In Stock

Description

Functional Roles

ZDHHC9 catalyzes protein S-palmitoylation, a reversible lipid modification regulating substrate localization and activity. Key functions include:

  • Ras Protein Palmitoylation: Modifies HRAS and NRAS, enabling their membrane association and oncogenic signaling .

  • Neuronal Plasticity: Critical for dendritic branching, synaptic formation, and myelinogenesis .

  • Cardiac Regulation: Controls Rab3a-mediated atrial natriuretic peptide (ANP) secretion in cardiomyocytes .

  • Immune Response: Palmitoylates gasdermin-D (GSDMD) to activate pyroptosis and cyclic GMP-AMP synthase (CGAS) for innate immunity .

Neurological Implications

  • Mutations in ZDHHC9 cause X-linked intellectual disability (XLID) with Marfanoid features and corpus callosum hypoplasia .

  • Knockout mice exhibit reduced white matter volume, impaired oligodendrocyte differentiation, and altered cholesterol metabolism .

Cardiovascular Effects

  • Transgenic overexpression in mice disrupts Rab3gap1 palmitoylation, leading to dilated cardiomyopathy and dysregulated ANP secretion .

Disease Models

ModelPhenotypeReference
Zdhhc9-KO miceCognitive deficits, seizures, myelin defects
Cardiomyocyte-specific TgDilated cardiomyopathy, ANP secretion defects

Applications in Research

  • Mechanistic Studies: Used to investigate palmitoylation kinetics and substrate specificity .

  • Therapeutic Development: Target for XLID, heart failure, and immune disorders .

  • Protein Interaction Assays: Paired with GOLGA7 to study Ras palmitoylation complexes .

Technical Notes

  • Avoid repeated freeze-thaw cycles; aliquot for long-term storage at -80°C .

  • Activity assays require reconstitution with glycerol (5–50%) to stabilize the enzyme .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ZDHHC9; Palmitoyltransferase ZDHHC9; Zinc finger DHHC domain-containing protein 9; DHHC-9; DHHC9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-364
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
ZDHHC9
Target Protein Sequence
MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYL AVQQSPAIPVFAAMLFLFSMATLLRASFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQ RPPPRIKNSQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRN YRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVV GLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRG ILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPDDSSTPEEMPPPEPPEPPQEAA EAEK
Uniprot No.

Target Background

Function

Recombinant Pongo abelii Palmitoyltransferase ZDHHC9 (ZDHHC9): A palmitoyltransferase catalyzing the addition of palmitate to various protein substrates. The ZDHHC9-GOLGA7 complex specifically palmitoylates HRAS and NRAS. ZDHHC9 may also palmitoylate the β-2 adrenergic receptor (ADRB2), thus influencing G protein-coupled receptor signaling.

Database Links
Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is ZDHHC9 and what is its primary molecular function?

ZDHHC9 (Zinc Finger DHHC-Type Palmitoyltransferase 9) is an enzyme involved in protein palmitoylation, a post-translational modification crucial for protein stability and membrane localization. It belongs to the DHHC domain-containing family of palmitoyltransferases . The enzyme catalyzes the transfer of palmitate to specific protein substrates through a two-step reaction process:

  • Autopalmitoylation: Formation of an enzyme-palmitoyl intermediate

  • Palmitoyl transfer: The palmitoyl moiety is transferred to a protein substrate or hydrolyzed if no substrate is available

ZDHHC9 is particularly significant in neurological development and has been implicated in multiple disease processes including X-linked intellectual disability, myelination disorders, and cancer .

What is known about the structure and conserved domains of ZDHHC9?

ZDHHC9 contains a highly conserved DHHC motif within its catalytic domain. The protein's active site consists of approximately 52 amino acid residues that are highly conserved across species . Key structural features include:

  • The DHHC motif (containing aspartic acid, histidine, histidine, and cysteine) which is essential for catalytic activity

  • Transmembrane domains that anchor the protein to cellular membranes

  • A conserved region surrounding amino acid positions R148 and P150, which are sites of disease-causing mutations

Comparison of ZDHHC9 with its paralogs shows that R148 and P150 residues are conserved in several related enzymes including ZDHHC14, ZDHHC5, ZDHHC18, ZDHHC8, and ZDHHC19, highlighting their functional importance .

What protein substrates are known to be palmitoylated by ZDHHC9?

ZDHHC9 has several verified protein substrates, with the most well-characterized being:

  • Ras proteins (NRAS and HRAS): ZDHHC9 catalyzes the palmitoylation of Ras proteins, which affects their subcellular localization and signaling capabilities

  • Rab3gap1: ZDHHC9 modifies this protein through palmitoylation, affecting its localization and activity in regulating Rab3a and vesicular trafficking

  • Proteins involved in myelin formation: ZDHHC9 appears to palmitoylate proteins essential for oligodendrocyte differentiation and myelin compaction, though specific substrates require further characterization

While these are the best-characterized substrates, researchers believe ZDHHC9 likely has additional protein targets that remain to be identified, particularly in cardiac tissue and cancer cells .

What experimental models are available for studying ZDHHC9 function?

Researchers can utilize several experimental models to study ZDHHC9:

  • Recombinant protein systems: Purified recombinant ZDHHC9, typically co-expressed with its accessory protein GCP16, can be used for in vitro enzymatic assays

  • Cell culture models:

    • Overexpression systems using plasmids encoding wild-type or mutant ZDHHC9

    • siRNA or shRNA knockdown approaches

    • Cancer cell lines (particularly TNBC) for studying ZDHHC9's role in cancer

  • Animal models:

    • Transgenic mice overexpressing ZDHHC9 in cardiomyocytes, which develop dilated cardiomyopathy

    • Zdhhc9 knockout mice, which exhibit defects in myelination and altered oligodendrocyte subtype proportions

    • Yeast complementation assays to assess ZDHHC9 function

These models offer complementary approaches to understand ZDHHC9 function in different cellular and physiological contexts.

How does the ZDHHC9-GCP16 complex function in protein palmitoylation?

ZDHHC9 requires complexing with GCP16 (Golgi-localized membrane protein, also known as GCP16) to be functionally active as a palmitoyltransferase . This relationship is similar to the yeast Erf2-Erf4 complex, suggesting evolutionary conservation of this mechanism.

Experimental approach to study the complex:

  • Co-expression of ZDHHC9 and GCP16 in bacterial or eukaryotic expression systems

  • Purification of the complex using affinity tags (such as His6-FLAG epitope)

  • In vitro reconstitution of palmitoylation activity using purified complexes and substrates

  • Analysis of complex formation and stability using co-immunoprecipitation

The complex primarily localizes to the Golgi apparatus, where it palmitoylates substrate proteins . Mutations that affect ZDHHC9 function (such as R148W and P150S) do not necessarily disrupt complex formation with GCP16 but rather impair enzymatic activity through other mechanisms .

What are the known mutations in ZDHHC9 and their effects on enzyme function?

Several mutations in ZDHHC9 have been identified and characterized:

MutationTypeEffect on Enzyme FunctionAssociated Condition
R148WMissenseReduced steady-state autopalmitoylationX-linked intellectual disability
P150SMissenseReduced steady-state autopalmitoylationX-linked intellectual disability
c.172_175dup (p.Y59fsX33)FrameshiftLikely loss of functionX-linked mental retardation
c.167+5G→CSplice-siteReduces splice donor site strength from 76.46% to 62.23%X-linked mental retardation
C169A (DHHC to DHHA)MissenseLoss of catalytic activityUsed experimentally as negative control

The R148W and P150S mutations specifically affect the autopalmitoylation step of the reaction, lowering the steady state amount of the palmitoyl-ZDHHC9 intermediate . Interestingly, while these mutations produce similar phenotypes, they appear to operate through distinct mechanisms at the molecular level .

What role does ZDHHC9 play in neurological development and disorders?

ZDHHC9 has significant implications for neurological development, with mutations linked to several neurological disorders:

  • X-linked intellectual disability (XLID): Mutations in ZDHHC9 are found in approximately 1.6% (4 of 250) of families with XLID, making it a significant contributor to this condition

  • Myelination defects: ZDHHC9 is critical for proper oligodendrocyte development and axon myelination. In Zdhhc9 knockout mice:

    • There is a decrease in MOL2/3 subtype cells (enriched for myelination genes)

    • A concomitant increase in MOL5/6 cells (enriched for cell adhesion and synaptic genes)

    • Reduced density of myelinated axons in the corpus callosum

    • Disruptions in myelin compaction and integrity

  • Molecular consequences: Transcriptomic and proteomic analyses of Zdhhc9 knockout mice reveal:

    • Reduced expression of genes essential for lipid metabolism and cholesterol synthesis

    • Decreased expression of proteins crucial for myelin compaction

Researchers seeking to understand ZDHHC9's role in neurological development should consider experimental approaches including primary oligodendrocyte cultures, brain slice imaging, and comprehensive phenotyping of animal models with ZDHHC9 mutations or knockout.

How is ZDHHC9 involved in cardiac function and natriuretic peptide secretion?

ZDHHC9 plays a significant role in cardiac function through regulation of the secretory pathway in cardiomyocytes:

  • Transgenic overexpression effects: Mice overexpressing ZDHHC9 in cardiomyocytes develop:

    • Dilated cardiomyopathy with advanced age

    • Enhanced palmitoylation and retention of Rab3gap1 at the Golgi

    • Elevated GTP-loading of Rab3a

    • Increased atrial ANP (Atrial Natriuretic Peptide) protein levels but reduced circulating ANP levels

  • Mechanistic pathway: ZDHHC9 regulates ANP secretion through:

    • Palmitoylation of Rab3gap1, affecting its localization and activity

    • Modulation of Rab3a-mediated exocytosis

    • Expansion of Rab3a-positive vesicles while impairing ANP secretion

  • Reciprocal relationship:

    • Acute silencing of ZDHHC9 enhances ANP secretion induced by phenylephrine in cultured myocytes

    • Basal ANP secretion is enhanced when Rab3gap1 (but not inactive mutants) is overexpressed

This regulatory mechanism represents an important link between post-translational modifications and cardiac hormone secretion, with potential implications for heart failure therapies.

What are the mechanistic differences between the R148W and P150S mutations in ZDHHC9?

The R148W and P150S mutations in ZDHHC9 both result in X-linked intellectual disability but operate through distinct molecular mechanisms:

  • Structural context: Both mutations occur in highly conserved residues within the active site of the palmitoyltransferase enzyme

  • Effect on autopalmitoylation: Both mutations affect the first step of the palmitoylation reaction (autopalmitoylation), resulting in lower steady-state levels of the palmitoyl-ZDHHC9 intermediate

  • Mechanistic differences:

    • The mutations likely affect different aspects of the catalytic process

    • They may alter substrate recognition, catalytic efficiency, or enzyme stability in subtly different ways

    • Despite producing similar phenotypic outcomes, the molecular pathways affected may differ

Experimental approaches to distinguish mechanisms:

  • Kinetic analysis of autopalmitoylation and transfer reactions using purified mutant proteins

  • Thin Layer Chromatography (TLC) to measure initial rates of substrate consumption and product release

  • Structural studies to determine how each mutation affects protein conformation

  • Yeast complementation assays to assess functional differences in vivo

Understanding these mechanistic differences could provide insights for developing targeted therapeutic approaches for individuals with specific ZDHHC9 mutations.

How does ZDHHC9 contribute to oligodendrocyte subtype determination and myelinogenesis?

ZDHHC9 plays a critical role in oligodendrocyte development and myelination through several mechanisms:

Experimental approaches for further study:

  • Single-cell RNA sequencing to characterize oligodendrocyte subtypes at different developmental stages

  • Live imaging of myelination in Zdhhc9 knockout models

  • Identification of ZDHHC9 substrates specific to oligodendrocyte lineage cells

  • Rescue experiments to determine if specific substrates can restore normal myelination

These findings suggest that ZDHHC9-mediated protein palmitoylation is a critical regulatory mechanism for oligodendrocyte cell fate decisions and myelin formation.

What is the relationship between ZDHHC9 expression and cancer, particularly in triple-negative breast cancer?

ZDHHC9 has emerged as a potential therapeutic target for triple-negative breast cancer (TNBC) through several key mechanisms:

  • Expression pattern and prognostic value:

    • ZDHHC9 is highly expressed in TNBC tissues compared to normal tissues

    • Elevated ZDHHC9 expression correlates with poor survival in TNBC patients

    • High ZDHHC9 expression is associated with increased Ki-67+ breast cancer cells

    • ZDHHC9 overexpression is particularly common in basal-like breast cancer

  • Immunotherapy resistance:

    • ZDHHC9 was identified as a key factor associated with resistance to immune checkpoint blockade (ICB) therapy

    • This association was discovered through weighted gene co-expression network analysis (WGCNA) and single-cell RNA sequencing (scRNA-seq)

  • Tumor immune microenvironment:

    • Knockdown of ZDHHC9 in murine TNBC cell line 4T1 improves the tumor immune microenvironment

    • This improvement may explain resistance to ICB therapy and provide a basis for combination therapy approaches

Research methodologies for investigating ZDHHC9 in cancer:

  • Analysis of ZDHHC9 expression in patient databases (TCGA, GEO)

  • Immunohistochemical staining of tumor tissues

  • Western blot analysis of protein expression

  • Flow cytometry to assess immune cell infiltration in tumors with different ZDHHC9 expression levels

  • In vivo studies using ZDHHC9 knockdown or overexpression in cancer models

These findings position ZDHHC9 as both a valuable diagnostic/prognostic marker and a potential therapeutic target for TNBC treatment.

What experimental approaches can be used to identify novel ZDHHC9 substrates?

Identifying novel substrates of ZDHHC9 is critical for understanding its diverse biological functions. Several complementary approaches can be employed:

  • Proteomics-based methods:

    • Acyl-biotin exchange (ABE) or acyl-resin-assisted capture (acyl-RAC) coupled with mass spectrometry

    • Comparison of palmitoylated proteomes in wild-type versus ZDHHC9 knockout/knockdown cells

    • Stable isotope labeling with amino acids in cell culture (SILAC) to quantify changes in protein palmitoylation

  • Biochemical approaches:

    • In vitro palmitoylation assays using purified ZDHHC9-GCP16 complex and candidate substrates

    • Thin layer chromatography (TLC) to detect palmitoylation of specific proteins

    • Metabolic labeling with palmitate analogs (e.g., 17-ODYA) followed by click chemistry

  • Genetic and cell biological methods:

    • Yeast two-hybrid screening to identify proteins that interact with ZDHHC9

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to ZDHHC9

    • Subcellular co-localization studies of ZDHHC9 with potential substrates

  • Computational prediction:

    • Machine learning algorithms to predict palmitoylation sites

    • Structural modeling to identify potential substrate binding sites on ZDHHC9

    • Analysis of protein sequences for consensus motifs recognized by ZDHHC9

When identifying novel substrates, it's important to validate findings using multiple complementary approaches and to demonstrate the functional significance of palmitoylation for each substrate.

What are the considerations for developing inhibitors or modulators of ZDHHC9 for therapeutic applications?

Developing targeted therapeutics against ZDHHC9 presents both opportunities and challenges:

  • Target validation considerations:

    • Determine tissue-specific effects of ZDHHC9 inhibition given its diverse physiological roles

    • Assess potential on-target adverse effects, particularly in neurological and cardiac tissues

    • Evaluate compensatory mechanisms through other DHHC family members

  • Structural considerations for inhibitor design:

    • Target the catalytic DHHC domain or substrate binding regions

    • Consider the requirement for GCP16 interaction for activity

    • Address the membrane-embedded nature of the protein, which may affect drug accessibility

    • Focus on conserved regions around R148 and P150, which are known to be functionally critical

  • Therapeutic contexts:

    • Triple-negative breast cancer: ZDHHC9 inhibition may enhance immunotherapy response

    • Cardiac conditions: Modulation of ZDHHC9 activity might affect ANP secretion and cardiac function

  • Screening approaches:

    • High-throughput screening using fluorescent or bioluminescent palmitoylation assays

    • Fragment-based drug discovery targeting specific protein domains

    • Repurposing of compounds known to affect other DHHC family members

    • Computer-aided drug design based on structural predictions

  • Delivery considerations:

    • Tissue-specific targeting to minimize off-target effects

    • Blood-brain barrier penetration if targeting neurological conditions

    • Subcellular targeting to the Golgi apparatus where ZDHHC9 is primarily localized

As ZDHHC9 is involved in multiple physiological processes, therapeutic development should carefully balance potential benefits in disease states against possible disruption of normal function.

What are the optimal techniques for detecting and measuring ZDHHC9 expression and activity?

Researchers can employ several complementary techniques to study ZDHHC9:

  • Protein detection methods:

    • Western blotting using specific ZDHHC9 antibodies

    • Immunofluorescence and immunohistochemistry for localization studies

    • Flow cytometry for cell surface and intracellular protein analysis

  • Activity assays:

    • Autopalmitoylation assays using labeled palmitoyl-CoA

    • Substrate palmitoylation assays using known targets like Ras proteins

    • Thin Layer Chromatography (TLC) to measure enzyme kinetics

  • Expression analysis:

    • RT-qPCR for mRNA quantification

    • RNA sequencing for transcriptomic profiling

    • Single-cell RNA sequencing to assess cell-type specific expression

For optimal results, researchers should combine multiple approaches to comprehensively characterize ZDHHC9 in their experimental systems.

How can researchers effectively study the ZDHHC9-GCP16 complex formation and activity?

The ZDHHC9-GCP16 complex is essential for palmitoyltransferase activity. Key methodological considerations include:

  • Complex reconstitution:

    • Co-expression using dual-promoter systems (e.g., GAL1,10 promoter in yeast)

    • Sequential or simultaneous purification of both proteins

    • Verification of complex formation through size exclusion chromatography or co-immunoprecipitation

  • Activity analysis:

    • Comparison of ZDHHC9 activity with and without GCP16

    • Structure-function studies to identify interaction domains

    • Site-directed mutagenesis to investigate complex stabilization

  • Structural characterization:

    • Cryo-EM or X-ray crystallography of the complex

    • Crosslinking mass spectrometry to identify interaction surfaces

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational changes

Researchers should note that some experimental systems may already express endogenous GCP16, potentially masking the effects of exogenous GCP16 addition.

What considerations are important when using ZDHHC9 knockout or transgenic models?

When utilizing genetic models to study ZDHHC9 function, researchers should consider:

  • Model generation approaches:

    • Conventional knockout versus conditional knockout strategies

    • Tissue-specific versus global knockout designs

    • Knockin of specific mutations (e.g., R148W, P150S) to model human diseases

  • Phenotypic characterization:

    • Comprehensive assessment of neurological, cardiac, and other physiological parameters

    • Age-dependent progression of phenotypes (e.g., dilated cardiomyopathy develops with age in cardiac-specific ZDHHC9 overexpression)

    • Molecular profiling through transcriptomics and proteomics

  • Complementary approaches:

    • Acute knockdown using siRNA or shRNA to distinguish developmental versus acute effects

    • Rescue experiments to verify specificity of observed phenotypes

    • Pharmacological manipulation to complement genetic approaches

  • Controls and validation:

    • Include appropriate genetic background controls

    • Validate knockout/transgene expression at both mRNA and protein levels

    • Consider compensatory upregulation of other DHHC family members

These considerations will help ensure robust and reproducible findings when using genetic models to study ZDHHC9 function.

What are the emerging areas of ZDHHC9 research with therapeutic potential?

Several promising research directions for ZDHHC9 are emerging:

  • Cancer therapeutics:

    • Development of ZDHHC9 inhibitors for triple-negative breast cancer

    • Combination approaches with immunotherapy based on ZDHHC9's role in immunotherapy resistance

    • Biomarker development for patient stratification

  • Neurological applications:

    • Targeted approaches to address myelination defects in ZDHHC9-related disorders

    • Gene therapy or protein replacement strategies for XLID caused by ZDHHC9 mutations

    • Small molecule screening to identify compounds that rescue function of mutant ZDHHC9

  • Cardiac therapeutics:

    • Modulation of ZDHHC9 activity to enhance ANP secretion in heart failure

    • Development of targeted approaches to prevent cardiomyopathy associated with ZDHHC9 dysregulation

As research progresses, integration of findings across these diverse physiological systems will be crucial for developing effective and safe therapeutic strategies.

How might advances in structural biology impact our understanding of ZDHHC9 function?

Structural biology approaches could significantly advance ZDHHC9 research:

  • Mechanistic insights:

    • Detailed understanding of the catalytic mechanism of palmitoylation

    • Structural basis for substrate recognition and specificity

    • Conformational changes during the catalytic cycle

  • Structure-guided drug design:

    • Identification of druggable pockets for small molecule development

    • Structure-based optimization of lead compounds

    • Design of allosteric modulators that affect specific functions

  • Disease-causing mutations:

    • Structural explanations for how mutations like R148W and P150S affect function

    • Potential for structure-guided therapeutic approaches to rescue mutant function

    • Insights into potential compensatory mechanisms

Advances in cryo-EM, computational modeling, and integrative structural biology will be particularly valuable for understanding this membrane-associated enzyme complex.

What potential biotechnology applications exist for recombinant ZDHHC9?

Recombinant ZDHHC9 has several potential biotechnology applications:

  • Enzyme-based biosensors:

    • Development of assays to detect palmitoylation inhibitors or enhancers

    • Screening platforms for drug discovery

  • Protein engineering:

    • Creating chimeric enzymes with altered substrate specificity

    • Development of controllable palmitoylation systems for synthetic biology

  • Diagnostic tools:

    • Development of assays to measure ZDHHC9 activity in patient samples

    • Biomarker applications for cancer prognosis and treatment selection

  • Research reagents:

    • Production of purified enzyme for in vitro studies

    • Development of activity-based probes for palmitoylation research

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.