Recombinant Pongo abelii Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

PTH1R is a receptor that binds parathyroid hormone (PTH) and parathyroid hormone-related protein (PTHrP) to regulate calcium and phosphate metabolism. In Pongo abelii (Sumatran orangutan), recombinant PTH1R mimics the native receptor’s function, enabling cross-species studies of ligand binding and signaling pathways .

Sequence Features

The extracellular domain (ECD) and transmembrane domain (TMD) are conserved across species, enabling functional studies. Key residues for ligand binding (e.g., PTH and PTHrP) are preserved .

Expression Systems and Purification

  • Hosts: Primarily expressed in E. coli for cost-effectiveness, though HEK293 and baculovirus systems are used for post-translational modifications .

  • Purification: Affinity chromatography via His tag, followed by size-exclusion chromatography .

  • Yield: Milligram quantities with >85% purity, validated by SDS-PAGE and endotoxin testing (<1 EU/μg) .

Signaling Mechanisms

PTH1R activates Gαs, Gαi, and Gαq pathways upon ligand binding, leading to cAMP production, calcium mobilization, and ERK phosphorylation . Key findings:

  • Ligand Specificity: PTH(1-34) and PTHrP(1-34) exhibit distinct G-protein activation profiles (PTH favors Gαs/Gαi, PTHrP biases toward Gαs) .

  • RAMP Modulation: Receptor Activity-Modifying Proteins (RAMP2/3) alter PTH1R trafficking and signaling:

    • RAMP2 enhances cAMP and calcium responses to PTH(1-34) .

    • RAMP3 reduces cell surface expression and attenuates signaling .

Therapeutic Development

  • Osteoporosis: Used to test PTH analogs (e.g., teriparatide, abaloparatide) for bone anabolic effects .

  • Disease Modeling: Humanized PTH1R mice (hPTH1R-KI) predict ligand efficacy in human bone and kidney cells .

Mechanistic Studies

  • Ligand Bias: PTH(1-34) shows prolonged cAMP signaling vs. transient responses with ABL, linked to RG vs. R0 receptor conformations .

  • Pathogenic Mutations: Jansen’s chondrodysplasia (gain-of-function) and Blomstrand chondrodysplasia (loss-of-function) are modeled using recombinant PTH1R .

Comparative Analysis with Human PTH1R

FeaturePongo abelii PTH1RHuman PTH1R
Sequence Identity~95%100% (reference)
Ligand BindingRetains high affinity for PTH/PTHrPSimilar affinity but species-specific differences in antagonist binding
Functional StudiesUsed to infer human receptor behaviorDirectly tested in clinical analogs

Challenges and Future Directions

  • Glycosylation Variability: Batch-to-batch differences in post-translational modifications affect functional assays .

  • RAMP Interactions: Further studies needed to exploit RAMP2-PTH1R complexes for biased agonism in osteoporosis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PTH1R; PTHR1; Parathyroid hormone/parathyroid hormone-related peptide receptor; PTH/PTHrP type I receptor; PTH/PTHr receptor; Parathyroid hormone 1 receptor; PTH1 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-594
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
DDVMTKEEQIFLLHRAQAQCGKRLKEVLQRPADIMESDKGWTSASTSGKPRKDKASGKLY PESEEDKEAPTDSRYRGRPCLPEWDHILCWPLGAPQGEVVAVPCPDYIYDFNHKGHAYRR CDRNGSWELVPGHNRTWANYSECVQFLTNETREREVFDRLGMIYTVGYSMSLASLTVAVL ILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQA PPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTVF GWGLPAVFVAVWVSVRATLANTGCWDLSSGNKKWIIQVPILASIVLHFILFINIVRVLAT KLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEMLF NSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSSSYSYGPMVSHTSVTN VGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKPGTPALETLETTPPATAAPKDDGFLNGS CSGLDEEASGPEQPPALLQEEWETVM
Uniprot No.

Target Background

Function
This receptor serves as the binding site for parathyroid hormone and parathyroid hormone-related peptide. Its activity is mediated by G proteins, which activate adenylyl cyclase and a phosphatidylinositol-calcium second messenger system.
Database Links
Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the PTH1R receptor and what are its key biological functions?

The parathyroid hormone 1 receptor (PTH1R) is a class B G protein-coupled receptor that mediates the actions of two primary ligands: parathyroid hormone (PTH) and parathyroid hormone-related peptide (PTHrP). Structurally, the Pongo abelii (Sumatran orangutan) PTH1R consists of 594 amino acids with an expression region spanning residues 29-594 .

PTH1R plays essential roles in multiple physiological systems. It serves as the primary mediator for calcium and phosphorus homeostasis through PTH's endocrine actions on bone . Additionally, it regulates skeletal development and bone turnover, and contributes to calcium regulation during pregnancy and lactation . Beyond these classical functions, PTH1R is expressed at varying levels across different tissues, where it facilitates numerous non-traditional paracrine and autocrine functions in response to locally produced PTHrP .

Pathologically, PTH1R is implicated in several disease states including osteoporosis, hypoparathyroidism, humoral hypercalcemia of malignancy, and various other malignant conditions . This broad involvement in both physiological processes and pathological states makes PTH1R a significant target for research into novel therapeutic approaches.

What are the recommended storage and handling conditions for recombinant Pongo abelii PTH1R protein to maintain optimal activity?

For optimal preservation of recombinant Pongo abelii PTH1R activity, specific storage and handling protocols should be followed. The protein is typically supplied in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein .

For standard storage, the protein should be maintained at -20°C, while extended storage requires conservation at either -20°C or -80°C . Working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw cycles, as repeated freezing and thawing is not recommended as it may compromise protein integrity and function .

When handling the protein, researchers should consider creating small working aliquots upon first thaw to prevent repeated freeze-thaw cycles of the stock solution. Additionally, maintaining appropriate buffer conditions is critical for preserving protein structure and function during experimental procedures.

How do PTH and PTHrP differentially interact with the PTH1R extracellular domain, and what structural factors determine binding specificity?

PTH and PTHrP exhibit different binding modes to the extracellular domain (ECD) of PTH1R despite activating the same receptor. Structural studies have revealed that these differences are accommodated by specific adaptations in the receptor binding groove .

The PTH1R accommodates the different binding patterns of PTH and PTHrP by shifting the side chain conformations of two key residues within the binding groove: Leu-41 and Ile-115 . Leu-41 functions as a rotamer toggle switch that adjusts to accommodate sequence divergence between PTH and PTHrP, while Ile-115 adapts to the specific curvature exhibited by PTHrP . This molecular flexibility allows a single receptor to effectively bind two structurally distinct ligands.

The binding interaction can be divided into two functional domains:

  • The N-terminal residues (1-13) of both PTH and PTHrP show significant sequence homology, reflecting their functional importance in PTH1R signaling . This region interacts with the extracellular loops of transmembrane helices 5 and 6 of the PTH1R and is essential for bioactivity through the cAMP/PKA pathway .

  • The 15-34 regions of both peptides, despite limited sequence homology, function as the principal ligand binding domains and interact with the extracellular N-terminal domain of PTH1R .

Binding studies using PTH/PTHrP hybrid ligands with reciprocal exchanges of residues have confirmed functional consequences for these altered interactions and enabled the design of modified PTH and PTHrP peptides that can adopt the ECD-binding mode of the opposite peptide .

What is the role of Receptor Activity Modifying Proteins (RAMPs) in modulating PTH1R signaling, and how do different RAMPs affect ligand binding and downstream pathways?

Receptor Activity Modifying Proteins (RAMPs) significantly influence PTH1R pharmacology and signaling in multiple ways. FRET imaging studies have demonstrated that PTH1R preferentially interacts with RAMP2 and, to a lesser extent, RAMP3, while showing no significant interaction with RAMP1 .

These RAMP interactions have distinct effects on PTH1R function:

  • RAMP2 co-expression:

    • Significantly enhances PTH1R-mediated cAMP accumulation

    • Increases β-arrestin recruitment

    • Augments calcium signaling

    • Increases PTH(1-34)-stimulated maximal activation (efficacy) of Gαs by 140% and Gαi by 60%

    • Does not significantly alter Gαq activation efficacy but reduces PTH-stimulated Gαq potency

  • RAMP3 co-expression:

    • Reduces cell surface expression of PTH1R, suggesting a role in receptor trafficking or internalization

    • Attenuates or completely abolishes PTH1R-mediated responses

    • Significantly reduces both potency and efficacy in multiple signaling pathways

The differential effects of RAMPs extend to ligand-specific responses as well. For example, PTHrP(1-34)-stimulated Gαs efficacy increases by approximately 150% with RAMP2 co-expression, without significant changes in Gαi or Gαq activation or potency .

These findings demonstrate that RAMPs serve as important accessory proteins that can modify PTH1R signaling in a complex manner, contributing to biased agonism and potentially explaining tissue-specific responses to PTH and PTHrP despite activation of the same receptor.

How does PTH1R exhibit biased signaling, and what are the experimental approaches to measure pathway-specific activation?

PTH1R exhibits well-characterized biased signaling, where different ligands or receptor modifications can preferentially activate distinct downstream pathways. This biased agonism involves differential activation and duration of cAMP production, calcium signaling, and β-arrestin recruitment, resulting in distinct physiological outcomes .

Key aspects of PTH1R biased signaling include:

  • G protein-coupled conformations: PTH1R can adopt at least two distinct conformations:

    • The R0 conformation, which is stable in the presence of GTPγS but presumably in the absence of G protein coupling, correlates with prolonged signaling responses and is bound preferentially by PTH(1-34) .

    • The RG conformation, which is sensitive to GTPγS addition, promoted by overexpression of high-affinity Gαs variants, and bound preferentially by PTHrP(1-36) .

  • Ligand-specific effects: Modified ligands can exhibit bias toward specific pathways:

    • N-terminally truncated PTH and PTHrP analogues may function as inverse agonists, reducing cAMP production in cells expressing constitutively active PTH1R mutants .

    • Hybrid peptides that bind the ECD poorly show selectivity for specific G protein-coupled PTH1R conformations .

To experimentally measure pathway-specific activation, researchers employ several approaches:

  • cAMP accumulation assays to assess Gαs activation

  • Calcium mobilization assays for Gαq pathway activation

  • β-arrestin recruitment assays using bioluminescence or fluorescence-based techniques

  • G protein activation assays that directly measure Gαs, Gαi, and Gαq activation

  • Receptor conformation studies using FRET or BRET technologies

The goal of understanding biased agonism in PTH1R signaling has therapeutic implications, particularly for designing ligands that can increase bone mass while reducing calciotropic effects in conditions such as osteoporosis .

What are the optimal expression systems for producing functional recombinant Pongo abelii PTH1R, and what purification strategies yield the highest activity?

While the search results don't provide specific details about expression systems optimized for Pongo abelii PTH1R, general approaches for GPCR expression and purification can be adapted based on structural studies of PTH1R.

For successful expression of functional recombinant PTH1R, several systems can be considered:

  • Mammalian expression systems (HEK293, CHO cells):

    • Provide native-like post-translational modifications and proper folding

    • Support functional studies of receptor signaling

    • Enable assessment of interactions with regulatory proteins like RAMPs

  • Insect cell expression systems (Sf9, Hi5):

    • Often yield higher protein quantities for structural studies

    • Provide eukaryotic processing capabilities

    • Used successfully for structural studies of related GPCRs

  • Fusion protein approaches:

    • Maltose-binding protein (MBP) fusion systems have been successfully employed for crystallography studies of the PTH1R extracellular domain complexed with PTHrP

    • The MBP-PTH1R ECD fusion approach yielded diffraction-quality crystals suitable for structural determination

Purification strategies that maintain receptor functionality typically involve:

  • Initial solubilization with mild detergents for membrane-bound full-length receptor

  • Affinity chromatography using epitope tags (His-tag, FLAG-tag)

  • Size exclusion chromatography for final polishing

  • Careful buffer optimization to maintain stability

For structural studies of PTH1R ECD:PTHrP complexes, researchers have successfully employed iterative cycles of rebuilding and restrained refinement with Refmac5, including TLS refinement using two TLS groups corresponding to the MBP-maltose complex and the ECD-PTHrP complex .

What experimental design considerations are critical when studying RAMP-PTH1R interactions, and how can researchers control for confounding variables?

When investigating RAMP-PTH1R interactions, several critical experimental design considerations must be addressed to ensure reliable and reproducible results:

  • Expression level control:

    • Standardize expression levels of both PTH1R and RAMPs to avoid artifacts from overexpression

    • Employ inducible expression systems to fine-tune protein levels

    • Quantify receptor and RAMP expression using techniques like western blotting or flow cytometry

  • Complex formation verification:

    • Confirm PTH1R-RAMP complex formation using techniques like FRET imaging, which has revealed preferential interaction with RAMP2 and lesser interaction with RAMP3

    • Employ co-immunoprecipitation to biochemically verify complex formation

    • Consider subcellular localization studies to assess trafficking effects

  • Signaling pathway isolation:

    • Design experiments to distinguish between different G-protein pathways (Gαs, Gαi, and Gαq)

    • Use pathway-specific inhibitors to isolate individual signaling cascades

    • Employ cell lines with reduced background signaling for the pathway of interest

  • Controlling for confounding variables:

    • Use appropriate vector controls in parallel experiments

    • Ensure comparable transfection efficiencies across experimental conditions

    • Account for potential differences in receptor trafficking (particularly important with RAMP3, which reduces cell surface expression of PTH1R)

    • Control for potential variation in ligand potency and efficacy across different cell preparations

  • Comprehensive signaling assessment:

    • Measure multiple signaling outcomes (cAMP accumulation, β-arrestin recruitment, calcium signaling) in the same cellular background

    • Compare responses across different time points to capture both immediate and sustained signaling events

    • Evaluate both potency (EC50) and efficacy parameters for comprehensive characterization

By addressing these considerations, researchers can generate more reliable data on how RAMPs differentially modulate PTH1R pharmacology with various PTH/PTHrP-related ligands, as demonstrated in previous studies showing that RAMP2 enhances while RAMP3 inhibits certain signaling pathways .

What are the most reliable assay systems for measuring PTH1R-mediated G protein activation, and how do they compare in sensitivity and specificity?

Several assay systems have been employed to measure PTH1R-mediated G protein activation, each with distinct advantages for sensitivity and specificity:

  • cAMP accumulation assays:

    • Commonly used to assess Gαs pathway activation

    • Methods include radioimmunoassay, ELISA-based detection, and newer FRET/BRET-based biosensors

    • FRET/BRET biosensors offer real-time, live-cell measurements with improved temporal resolution

    • Research shows RAMP2 significantly enhances both potency and maximal response to PTH(1-34) in cAMP accumulation compared to PTH1R alone

  • Direct G protein activation assays:

    • Measure activation of specific G proteins (Gαs, Gαi, Gαq)

    • Allow assessment of how interactions, like those with RAMP2, increase PTH(1-34)-stimulated maximal activation of Gαs by 140% and Gαi by 60%

    • Enable detection of subtle effects, such as reduced PTH-stimulated Gαq potency in PTH1R-RAMP2 complexes

  • β-arrestin recruitment assays:

    • Techniques include enzyme complementation assays and BRET-based platforms

    • Detect conformational changes associated with β-arrestin binding

    • Studies show RAMP2 significantly increases efficacy of PTH(1-34) in β-arrestin recruitment, while RAMP3-transfected cells show no detectable response

  • Calcium mobilization assays:

    • Fluorescent calcium indicators measure intracellular calcium release

    • Assess primarily Gαq pathway activation but can detect Gβγ-mediated calcium release from Gαi activation

    • Allow for kinetic analysis of signaling responses

Comparative performance:

Assay TypeSensitivitySpecificityTemporal ResolutionThroughputKey Advantage
cAMP (ELISA)HighHighEndpointMediumQuantitative, established
cAMP (FRET)Medium-HighHighReal-timeHighKinetic analysis
Direct G proteinVery HighHighestVariableLow-MediumPathway specificity
β-arrestinHighHighReal-timeHighMeasures receptor desensitization
Calcium fluxMedium-HighMediumReal-timeHighRapid response detection

When selecting an assay system, researchers should consider that different assays may yield somewhat different results. For example, changes in ligand potency observed in G protein activation may not directly correlate with effects seen in downstream signaling pathways, as demonstrated by the differential effects of RAMP2 on PTH-stimulated Gαq potency versus other pathways .

How can researchers design PTH/PTHrP hybrid ligands to investigate specific binding domains, and what structural considerations are critical for success?

The design of PTH/PTHrP hybrid ligands represents a sophisticated approach to investigate specific binding domains and receptor interactions. Based on structural studies, several critical considerations guide successful hybrid ligand design:

  • Functional domain understanding:

    • The N-terminal residues (1-13) of PTH and PTHrP share significant sequence homology and are critical for receptor activation through the cAMP/PKA pathway

    • The 15-34 regions function as principal ligand binding domains despite limited sequence homology

    • Beyond residue 34, there is no identifiable similarity between PTH and PTHrP

  • Strategic exchange points:

    • Reciprocal exchanges of residues involved in different contacts can confirm functional consequences of altered interactions

    • Hybrid ligands that bind the extracellular domain (ECD) poorly often demonstrate selectivity for specific G protein-coupled PTH1R conformations

    • N-terminally truncated PTH and PTHrP analogs (missing 2-6 N-terminal residues) can function as antagonists or inverse agonists

  • Structural considerations:

    • The receptor accommodates different ligand binding modes by shifting side chain conformations of two key residues: Leu-41 and Ile-115

    • Leu-41 acts as a rotamer toggle switch to accommodate sequence divergence between PTH and PTHrP

    • Ile-115 adapts to the specific curvature of PTHrP

  • Design strategy examples:

    • Substitution of key residues involved in ECD contacts can alter binding mode while maintaining activation potential

    • Reciprocal exchanges between PTH and PTHrP at positions that make different contacts with the receptor

    • Introduction of conformational constraints to favor specific binding orientations

  • Validation approaches:

    • Binding affinity assays to confirm ECD interaction

    • Functional assays measuring multiple signaling pathways to assess biased activation

    • Structural studies (when possible) to confirm binding mode

This strategic approach has enabled researchers to design modified PTH and PTHrP peptides that adopt the ECD-binding mode of the opposite peptide , providing valuable tools for investigating receptor activation mechanisms and developing potential therapeutics with tailored signaling profiles.

What are the molecular mechanisms underlying the differential effects of RAMP2 versus RAMP3 on PTH1R trafficking and signaling?

The molecular mechanisms underlying the differential effects of RAMP2 versus RAMP3 on PTH1R function involve distinct processes affecting receptor trafficking, ligand recognition, and signaling pathway activation:

  • Receptor trafficking differences:

    • RAMP3 co-expression results in reduced cell surface expression of PTH1R, suggesting a role in receptor internalization or intracellular retention

    • RAMP2 does not appear to significantly alter receptor surface expression, indicating different regulatory mechanisms

    • These trafficking differences may involve distinct interactions with intracellular trafficking machinery or differences in receptor stabilization at the plasma membrane

  • Pathway-specific modulation:

    • RAMP2 enhances multiple PTH1R-mediated signaling pathways:

      • Increases PTH(1-34)-stimulated Gαs activation efficacy by 140%

      • Enhances Gαi activation efficacy by 60%

      • Significantly improves both potency and maximal response to PTH(1-34) in cAMP accumulation

      • Increases efficacy of PTH(1-34) in β-arrestin recruitment

    • RAMP3 exerts primarily inhibitory effects:

      • Significantly reduces potency in cAMP pathways

      • Completely abolishes detectable response to PTH(1-34) in β-arrestin assays

      • Causes significant reduction in both potency and efficacy of PTHrP(1-34)

  • Ligand-specific effects:

    • The influence of RAMPs varies depending on the activating ligand

    • RAMP2 causes different patterns of enhancement for PTH versus PTHrP responses

    • For PTHrP(1-34), RAMP2 significantly increases both potency and efficacy, while RAMP3 reduces both parameters

  • Proposed molecular mechanisms:

    • Allosteric modulation of receptor conformation by RAMPs, altering ligand binding pocket geometry

    • Differential effects on G protein coupling efficiency through stabilization of specific receptor conformations

    • Altered recruitment of signaling or regulatory proteins

    • Modification of receptor phosphorylation patterns affecting desensitization and internalization

These findings suggest that RAMPs act as sophisticated modulators of PTH1R function, with RAMP2 primarily enhancing signaling while RAMP3 exhibits inhibitory functions. This complexity has significant implications for understanding tissue-specific differences in PTH1R signaling and for developing therapeutic approaches targeting specific RAMP-receptor complexes.

How does the structure-function relationship of PTH1R differ between Pongo abelii and human models, and what implications does this have for translational research?

While the search results don't provide direct comparative data between Pongo abelii and human PTH1R, we can infer several important considerations for translational research based on known structure-function relationships:

  • Evolutionary conservation:

    • Class B GPCRs like PTH1R typically show high sequence conservation in functional domains across species

    • The extracellular N-terminal domain that interacts with the 15-34 portions of PTH and PTHrP is likely highly conserved

    • Transmembrane domains that interact with the N-terminal portions of ligands to initiate signaling also tend to be well-preserved

  • Potential structural differences:

    • Even minor sequence variations in the ligand binding pocket could alter binding affinities

    • Differences in post-translational modification sites might affect receptor processing, trafficking, or regulation

    • Species-specific variations in key residues like Leu-41 and Ile-115 (which accommodate different ligand binding modes) could influence ligand selectivity

  • Signaling pathway considerations:

    • Coupling efficiency to downstream G proteins may vary between species

    • Interaction with regulatory proteins (including RAMPs) might show species-specific patterns

    • PTH1R in different species may exhibit different biased signaling profiles

  • Translational research implications:

    • Data from non-human primate models requires careful validation in human systems

    • Therapeutic candidates developed using Pongo abelii PTH1R models might show altered pharmacology in human systems

    • Understanding species differences is crucial for interpreting preclinical efficacy and safety data

  • Experimental approach recommendations:

    • Conduct comparative binding and signaling studies with identical ligands across species variants

    • Perform site-directed mutagenesis to identify functionally important residues that differ between species

    • Use computational modeling to predict the impact of sequence variations on structure and function

For robust translational research, it's advisable to characterize both the Pongo abelii and human receptor variants under identical experimental conditions to identify any significant functional differences that might affect drug development or basic mechanistic studies.

How do mutations in PTH1R contribute to human diseases, and what experimental models best recapitulate these pathological states?

Mutations in PTH1R are associated with several human diseases that highlight the receptor's crucial role in skeletal development and calcium homeostasis. The search results mention specific genetic disorders related to PTH1R mutations, with Jansen's metaphyseal chondrodysplasia being explicitly identified .

  • Disease-associated mutations:

    • Jansen's metaphyseal chondrodysplasia is associated with constitutively active mutants of PTH1R

    • The constitutive activity leads to ligand-independent signaling and dysregulated calcium metabolism

    • Other PTH1R-associated conditions include:

      • Blomstrand chondrodysplasia (inactivating mutations)

      • Primary failure of tooth eruption

      • Ollier disease and Maffucci syndrome (somatic mutations)

  • Mechanistic insights:

    • N-terminally-truncated PTH and PTHrP analogues can function as inverse agonists, blunting cAMP production in cells expressing constitutively active PTH1R mutants

    • This suggests potential therapeutic approaches for conditions with activating mutations

    • Different mutations affect distinct aspects of receptor function including ligand binding, G protein coupling, and receptor trafficking

  • Experimental models:

    • Cell-based systems:

      • Transfected cell lines expressing disease-associated PTH1R mutations

      • CRISPR-modified cells with endogenous receptor mutations

      • Primary cells from patient samples

    • Animal models:

      • Transgenic mice expressing mutant PTH1R

      • Knock-in models with specific human mutations

      • Conditional tissue-specific expression systems

    • Ex vivo models:

      • Organ culture systems using bone or cartilage explants

      • Patient-derived organoids or tissue cultures

  • Model selection considerations:

    • The choice of model depends on the specific aspect of disease being studied

    • For Jansen's chondrodysplasia, chondrocyte-specific expression models are most relevant

    • For metabolic phenotypes, models should focus on PTH1R function in bone and kidney

    • Species differences in PTH1R signaling must be considered when interpreting model data

These experimental models provide platforms for both investigating disease mechanisms and testing potential therapeutic approaches, including inverse agonists for conditions with constitutively active receptors or targeted therapies for specific pathogenic pathways.

What are the current strategies for developing biased PTH1R agonists, and how might RAMP-targeted approaches enhance therapeutic specificity?

The development of biased PTH1R agonists represents a promising therapeutic strategy, with recent research highlighting the potential of RAMP-targeted approaches to enhance specificity:

  • Current biased agonist development strategies:

    • Modification of ligand N-terminal regions (residues 1-13) to alter activation profiles while maintaining binding via the 15-34 region

    • Development of ligands that preferentially interact with specific receptor conformations (R0 versus RG)

    • Creation of hybrid peptides that combine portions of PTH and PTHrP to achieve desired signaling bias

    • Structure-guided design based on the distinct binding modes of PTH versus PTHrP

  • Therapeutic goals:

    • For osteoporosis treatment: Developing agonists that increase bone mass while reducing calciotropic effects

    • For hypoparathyroidism: Creating long-acting PTH analogs with controlled calcium mobilization

    • For hypercalcemic conditions: Designing antagonists or inverse agonists that block PTH1R signaling

  • RAMP-targeted approaches:

    • Leveraging the differential effects of RAMP2 versus RAMP3 on PTH1R signaling

    • Designing ligands that preferentially activate PTH1R in complex with specific RAMPs

    • Targeting tissue-specific RAMP-PTH1R complexes to enhance therapeutic selectivity

    • Developing compounds that modulate RAMP-PTH1R interactions rather than directly targeting the receptor

  • Evidence supporting RAMP-targeted strategy:

    • RAMP2 significantly enhances PTH1R-mediated cAMP accumulation, β-arrestin recruitment, and calcium signaling

    • RAMP3 attenuates or abolishes these responses, suggesting that RAMP3-PTH1R complexes could be targeted to reduce signaling

    • The presence of RAMP2 differentially modulates potency and efficacy of PTH/PTHrP related peptides in activating G proteins and recruiting β-arrestins

  • Challenges and considerations:

    • Tissue-specific expression patterns of RAMPs must be considered when developing targeted therapies

    • The complex interplay between different signaling pathways requires careful pharmacological characterization

    • Developing ligands that specifically recognize RAMP-receptor complexes presents technical challenges

These RAMP-targeted approaches represent a new frontier in PTH1R pharmacology, potentially allowing for unprecedented specificity in modulating calcium homeostasis and bone metabolism with reduced off-target effects.

How can structural insights from PTH1R binding studies inform the design of novel peptide and non-peptide therapeutics?

Structural insights from PTH1R binding studies provide critical guidance for designing novel therapeutics with improved specificity and efficacy:

  • Extracellular domain (ECD) binding mechanisms:

    • The receptor accommodates different binding modes by shifting side chain conformations of key residues: Leu-41 and Ile-115

    • Leu-41 functions as a rotamer toggle switch to accommodate sequence divergence between PTH and PTHrP

    • Ile-115 adapts to the specific curvature of PTHrP

    • These insights allow for rational modification of ligand structure to optimize binding

  • Functional domain exploitation:

    • The N-terminal residues (1-13) control bioactivity through interactions with transmembrane domains

    • The 15-34 regions function as the principal ligand binding domains

    • Designing peptides with modified N-terminal regions can yield antagonists or inverse agonists

    • This domain separation enables creation of ligands with tailored functionality while maintaining binding affinity

  • Receptor conformation targeting:

    • PTH1R can adopt different conformations (R0 and RG) with distinct ligand preferences

    • Developing ligands that preferentially stabilize specific conformations can drive biased signaling

    • Hybrid peptides with poor ECD binding show selectivity for particular G protein-coupled conformations

  • Non-peptide therapeutic opportunities:

    • Crystal structures of PTH1R complexes provide templates for computational drug design

    • Small molecule development can target specific binding pockets identified in structural studies

    • Allosteric modulators could be designed to influence receptor-RAMP interactions

    • Structure-based fragment screening can identify novel chemical scaffolds for drug development

  • Translation to therapeutic design:

    • For osteoporosis: Compounds that favor anabolic bone formation over calcium mobilization

    • For hypoparathyroidism: Long-acting PTH mimetics with controlled signaling profiles

    • For hypercalcemic conditions: Antagonists that block specific pathological signaling pathways

    • For RAMP-targeted approaches: Molecules that modulate specific RAMP-PTH1R interactions

The molecular model established through these structural studies provides a valuable template for rational drug design, offering opportunities to develop more effective therapeutics for various PTH1R-related conditions with improved specificity and reduced side effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.