Recombinant Pongo abelii Phosphate carrier protein, mitochondrial (SLC25A3)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview of Recombinant Pongo abelii Phosphate Carrier Protein (SLC25A3)

The Recombinant Pongo abelii Phosphate carrier protein, mitochondrial (SLC25A3) is a recombinant form of the mitochondrial carrier family protein SLC25A3, homologous to human and other mammalian orthologs. This protein facilitates the transport of phosphate (Pi) and copper (Cu) across the mitochondrial inner membrane, playing a critical role in oxidative phosphorylation and cytochrome c oxidase (COX) assembly . The recombinant version is produced via heterologous expression in Escherichia coli and is used extensively in biochemical and structural studies to elucidate substrate specificity, evolutionary relationships, and functional mechanisms .

Protein Structure

The full-length SLC25A3 protein (amino acids 50–361) from Pongo abelii includes six transmembrane domains arranged in three repeats, forming a conserved mitochondrial carrier fold . Key structural features include:

  • N-terminal His-tag: Facilitates purification via affinity chromatography .

  • Evolutionary conservation: Shares >90% sequence identity with human SLC25A3, enabling cross-species functional studies .

  • Critical residues: Leucine 175 (L175) and Histidine 75 (H75) are critical for copper and phosphate transport, as demonstrated by mutagenesis studies .

Dual Substrate Transport

SLC25A3 uniquely transports both phosphate and copper in mammals, unlike yeast, where these functions are partitioned between paralogs PIC2 (copper) and MIR1 (phosphate) . Key findings include:

  • Copper transport: SLC25A3 delivers copper to the mitochondrial matrix for COX assembly, as shown by COX deficiency in Slc25a3 knockout (KO) cells and rescue via copper supplementation .

  • Phosphate transport: Essential for ATP synthesis and mitochondrial calcium handling, with defects linked to muscle myopathy and cardiomyopathy .

  • Substrate specificity: Mutagenesis (e.g., L175A variant) separates copper and phosphate transport, retaining copper transport while abolishing phosphate uptake .

Table 2: Functional Studies of SLC25A3

Study TypeOutcomeSource
Mutagenesis (L175A)Retains copper transport; abolishes phosphate uptake
Slc25a3 KO in MEFsCOX deficiency rescued by copper supplementation
Yeast complementationHuman SLC25A3 restores copper uptake in pic2Δ yeast
Liposomal reconstitutionTransport of copper (but not other metals) confirmed in vitro

Human Disorders

Mutations in SLC25A3 are associated with severe metabolic disorders, including:

  • Muscle hypotonia: Linked to impaired phosphate transport and ATP synthesis .

  • Hypertrophic cardiomyopathy: Caused by defective copper delivery to COX and SOD1, leading to mitochondrial dysfunction .

  • Fatal infantile conditions: Rare SLC25A3 mutations result in lactic acidosis and early mortality .

Table 3: Clinical Implications of SLC25A3 Defects

DisorderMechanismSource
Hypertrophic cardiomyopathyImpaired COX activity due to copper deficiency
Muscle myopathyATP depletion from phosphate transport defects
Lactic acidosisCompromised oxidative phosphorylation

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A3; PHC; Phosphate carrier protein, mitochondrial; Phosphate transport protein; PTP; Solute carrier family 25 member 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
50-361
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
SLC25A3
Target Protein Sequence
AVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVT LKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASA SAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPY TMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSV LNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEM PESLKKKLGLTQ
Uniprot No.

Target Background

Function
Facilitates the transport of phosphate groups from the cytosol to the mitochondrial matrix. Phosphate is cotransported with H(+). This protein might play a role in regulating the mitochondrial permeability transition pore (mPTP).
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What are the isoforms of SLC25A3 and how do they differ functionally?

SLC25A3 exists in two major isoforms created by alternative splicing of exon 3:

IsoformExpression PatternPhosphate Transport RateAmino Acid Difference
SLC25A3-AHeart and skeletal muscleLower (baseline)Differs by 13 amino acids between residues 54-80
SLC25A3-BAll other tissues~3-fold higher than ADiffers by 13 amino acids between residues 54-80

This tissue-specific expression pattern is functionally significant. SLC25A3-B demonstrates approximately three times higher phosphate transport capacity than SLC25A3-A when purified and reconstituted in liposomes . Despite these differences in phosphate transport capacity, both isoforms appear to have similar copper transport properties with an apparent transport affinity of 15 μM and a specific activity of approximately 25 mmol of copper/min/g under standard conditions .

How does recombinant SLC25A3 from Pongo abelii compare to human SLC25A3?

Comparing Pongo abelii and human SLC25A3 reveals high evolutionary conservation, reflecting the essential nature of this protein's function. While specific comparison data between human and Pongo abelii SLC25A3 is limited in the provided search results, we can infer significant functional similarity based on the conservation patterns observed across other great apes.

Research examining transporter function across primates has demonstrated that orthologous transporters typically maintain their core functional properties with subtle species-specific modifications. For example, in studies of other transporters in the SLC family (such as SLC22A10), great ape variants shared substantial structural and functional similarities while exhibiting species-specific expression patterns and substrate affinities .

When studying recombinant Pongo abelii SLC25A3, researchers should be aware that while core transport functions are likely conserved, there may be subtle differences in regulatory mechanisms, protein stability, or post-translational modifications compared to the human ortholog.

What methods are effective for assessing SLC25A3 phosphate transport activity?

Researchers investigating SLC25A3 phosphate transport activity can employ several established methodologies:

  • Liposome reconstitution assays: Purify SLC25A3 from expression systems like E. coli, reconstitute into liposomes, and measure phosphate uptake using radiolabeled phosphate or fluorescent phosphate analogs. This approach has been used extensively to assess substrate transport and specificity for mitochondrial carrier family proteins .

  • Mitochondrial isolation and transport assays: Isolate intact mitochondria from cells expressing SLC25A3 and measure phosphate uptake using radiolabeled phosphate (32P) or phosphate analogs like arsenate.

  • Competition assays: Assess phosphate transport in the presence of potential competitors or inhibitors. For example, arsenate has been shown to inhibit the initial rate of copper transport in both SLC25A3-A and SLC25A3-B, suggesting overlapping transport pathways .

  • Mutagenesis studies: Introduce specific mutations to identify residues critical for phosphate transport. The L175A variant of mouse SLC25A3 maintains copper transport ability but loses phosphate transport function, making it valuable for distinguishing between these dual functions .

  • pH and ion dependence analysis: Measure transport activity across different pH values and ionic conditions to determine the transport mechanism. For example, investigating transport in sodium-free or chloride-free buffers can reveal ion dependencies similar to those studied for other transporters .

How can researchers effectively study the copper transport function of SLC25A3?

To investigate SLC25A3's copper transport function, researchers have utilized several complementary approaches:

  • Liposome reconstitution with copper: Purify SLC25A3 and reconstitute it into liposomes to measure copper uptake. Both SLC25A3-A and SLC25A3-B isoforms have been shown to transport copper into liposomes without internal counter substrates, suggesting they function as unidirectional copper transporters .

  • Metal specificity assays: Test transport of various metals (calcium, zinc, magnesium, iron) to determine specificity. Research has shown that SLC25A3 appears specific for copper and does not transport other tested metals .

  • Fluorescence anisotropy: This technique can detect interactions between SLC25A3 and fluorescent anionic copper complexes. Increasing concentrations of human SLC25A3-A have been shown to stabilize the rotational time of copper ligands, suggesting direct interaction .

  • Cytochrome c oxidase (COX) activity assays: Since copper transport by SLC25A3 affects COX assembly, measuring COX activity provides an indirect assessment of copper transport function. COX deficiency in cells with reduced SLC25A3 can be suppressed by copper supplementation, confirming the link between SLC25A3 and copper delivery to COX .

  • Mitochondrial copper sensing: Using mitochondrially targeted copper sensors can reveal changes in mitochondrial copper content after manipulation of SLC25A3 expression. Studies have shown that total mitochondrial copper content is significantly reduced in SLC25A3 knockout cells and increases when functional copper transport variants are expressed .

What expression systems are optimal for producing functional recombinant SLC25A3?

Several expression systems have been successfully used to produce functional recombinant SLC25A3:

  • Bacterial expression (E. coli): SLC25A3 can be expressed with a His6 tag in E. coli and purified from inclusion bodies before reconstitution into liposomes. This approach has been used extensively to assess substrate transport and specificity for mitochondrial carrier family proteins .

  • Mammalian cell expression: For functional studies in a more native environment, SLC25A3 variants can be expressed in immortalized mouse embryonic fibroblasts (MEFs) with knockout or floxed SLC25A3 alleles. This system allows assessment of physiological functions through rescue experiments .

  • Retroviral expression systems: Gateway-modified retroviral expression vectors containing SLC25A3 cDNA have been successfully used with the Phoenix Amphotrophic packaging cell line to transduce MEFs .

For biochemical studies requiring larger protein quantities, E. coli remains the preferred system, while mammalian expression is better suited for functional characterization in a physiologically relevant context.

What is the relationship between SLC25A3's phosphate and copper transport functions?

The relationship between SLC25A3's phosphate and copper transport functions reveals sophisticated molecular specialization:

  • Separable but related functions: Point mutations can separate phosphate and copper transport functions. The L175A variant of mouse SLC25A3 retains copper transport ability but loses phosphate transport function, demonstrating that these functions can be mechanistically uncoupled .

  • Shared inhibition patterns: Both transport activities show some common regulatory features. For example, arsenate (an inorganic phosphate analog) inhibits the initial rate of copper transport in both SLC25A3-A and SLC25A3-B, suggesting that phosphate and copper may interact with overlapping binding sites or transport pathways .

  • Isoform-specific differences: While SLC25A3-B has approximately three times higher phosphate transport capacity than SLC25A3-A, both isoforms appear to have similar copper transport properties, with an apparent transport affinity of 15 μM and a specific activity of approximately 25 mmol of copper/min/g under standard conditions . This suggests differential evolution of these two transport functions.

  • Structure-function relationship: Molecular modeling of SLC25A3 based on related transporters has helped identify critical residues. For example, His75 in murine SLC25A3 (equivalent to His33 in PIC2) appears essential for both transport functions, as the H75A SLC25A3 variant fails to rescue COX deficiency in knockout cells .

This dual functionality makes SLC25A3 an intriguing model for understanding how transporters can evolve multiple substrate specificities while maintaining regulatory control.

How does SLC25A3 dysfunction impact mitochondrial function?

SLC25A3 dysfunction has profound effects on mitochondrial function through multiple mechanisms:

  • COX assembly disruption: SLC25A3 depletion in human and mouse cells causes cytochrome c oxidase (COX) deficiency that can be suppressed by copper supplementation. This indicates that impaired copper transport to COX during holoenzyme assembly is a major consequence of SLC25A3 dysfunction .

  • Bioenergetic impairment: As a phosphate transporter, SLC25A3 is essential for ATP synthesis by providing inorganic phosphate for oxidative phosphorylation. Reduced SLC25A3 function limits ATP production, contributing to the multisystem disorders observed in patients with SLC25A3 mutations .

  • Isoform-specific pathology: Mutations in the third exon specific to the SLC25A3-A isoform (expressed in heart and skeletal muscle) lead to multisystem disorders characterized by muscle hypotonia, lactic acidosis, and hypertrophic cardiomyopathy. These patients show phenotypes consistent with decreased ATP production due to limiting phosphate availability .

  • Copper homeostasis disruption: SLC25A3 knockout results in significantly reduced total mitochondrial copper content. This copper deficiency can be restored by expressing functional copper transport variants of SLC25A3, demonstrating its critical role in mitochondrial copper homeostasis .

  • Compensatory mechanisms: In some cases, high copper levels present at birth may partially compensate for loss of SLC25A3 function by redistributing copper to peripheral tissues, allowing for partial rescue of COX activity. This compensation may explain why some patients with SLC25A3 mutations show milder phenotypes than predicted .

What structural features determine substrate specificity in SLC25A3?

Key structural determinants of SLC25A3 substrate specificity have been identified through molecular modeling, mutagenesis, and comparative analysis:

  • Critical amino acid residues: Specific amino acids play crucial roles in determining substrate transport capabilities. For example:

    • His75 in murine SLC25A3 (equivalent to His33 in PIC2) appears essential for both transport functions, as the H75A variant fails to rescue COX deficiency in knockout cells .

    • Leu175 in murine SLC25A3 is critical for phosphate but not copper transport, as the L175A variant retains copper transport while losing phosphate transport ability .

  • Transmembrane domain organization: Like other members of the SLC25 family, SLC25A3 likely contains six transmembrane helices that form a transport channel across the inner mitochondrial membrane. The precise arrangement of these helices creates substrate-specific binding pockets and translocation pathways .

  • Molecular modeling insights: Atomic models of murine SLC25A3 have been constructed based on the structures of related transporters like the ATP/ADP carrier. These models reveal important features like helix positions, side chain packing, and hydrogen bonding patterns that contribute to substrate specificity .

  • Substrate interaction sites: Fluorescence anisotropy studies have demonstrated that SLC25A3 can interact with fluorescent anionic copper complexes, suggesting specific binding sites for copper coordination .

  • Isoform-specific regions: The 13 amino acid difference between SLC25A3-A and SLC25A3-B isoforms (located between residues 54-80) results in a three-fold difference in phosphate transport rates, highlighting this region's importance in determining transport kinetics .

What disease phenotypes are associated with SLC25A3 mutations?

Mutations in SLC25A3 are associated with several clinical manifestations:

Understanding these disease phenotypes provides valuable insights into SLC25A3 function and may guide the development of targeted therapies for affected patients.

How has SLC25A3 evolved across primate species?

The evolutionary trajectory of SLC25A3 across primates reveals important insights into its functional conservation and adaptation:

  • High sequence conservation: SLC25A3 is highly conserved across primates, reflecting its essential role in mitochondrial function. For example, mouse and yeast orthologs (SLC25A3 and PIC2, respectively) show 47% identity and 64% similarity over 312 residues with only 8% indels, indicating strong evolutionary pressure to maintain function .

  • Differential isoform expression: The tissue-specific expression pattern of SLC25A3 isoforms (SLC25A3-A in heart and skeletal muscle, SLC25A3-B in other tissues) appears to be conserved across mammals, suggesting that this specialization emerged early in mammalian evolution .

  • Functional conservation: Both phosphate and copper transport functions appear to be conserved across species, though the relative importance of each function may vary. This dual functionality suggests that SLC25A3 has been under selective pressure to maintain both transport capabilities throughout evolution .

  • Species-specific adaptations: While the core functions are conserved, species-specific differences in regulatory mechanisms, protein stability, or post-translational modifications may exist. These adaptations could reflect differences in metabolic demands, environmental factors, or genetic context across primate species.

  • Comparison with other transporters: Studies of other transporters in the SLC family show that orthologous transporters generally maintain their core functional properties with subtle species-specific modifications. For example, in studies of SLC22A10, great ape variants shared substantial structural and functional similarities while exhibiting species-specific expression patterns and substrate affinities .

What are the optimal buffer conditions for studying SLC25A3 transport activity?

Optimizing buffer conditions is critical for accurate assessment of SLC25A3 transport activity:

  • pH considerations: Transport activity should be evaluated across different pH levels (typically 5.5, 7.4, and 8.5) to determine pH dependence. For SLC22 family transporters, which share some characteristics with SLC25A3, pH adjustments can be made using hydrochloric acid or sodium hydroxide .

  • Ion composition: Different ionic conditions should be tested to identify dependencies on specific ions:

    • Sodium dependence: Compare transport in sodium-containing buffer (140 mM NaCl, 4.73 mM KCl, 1.25 mM CaCl2, 1.25 mM MgSO4, and 5 mM HEPES, pH 7.4) versus sodium-free buffer (140 mM N-methyl-D-glucamine chloride with equivalent concentrations of other ions) .

    • Chloride dependence: Compare transport in standard buffer versus chloride-free buffer (using gluconate salts: 125 mM sodium gluconate, 4.8 mM potassium gluconate, etc.) .

  • Trans-stimulation conditions: For trans-stimulation studies investigating exchange mechanisms, pre-incubation with potential counter-substrates (such as dicarboxylic acids at 2 mM concentration) can reveal important aspects of the transport mechanism .

  • Storage conditions: For purified recombinant SLC25A3, optimal storage includes Tris-based buffer with 50% glycerol at -20°C for standard storage or -80°C for extended periods. Repeated freezing and thawing should be avoided, with working aliquots stored at 4°C for up to one week .

  • Technical replicates: All transport assays should be performed with at least three or four technical replicates and replicated in independent experiments to ensure reproducibility of results .

What are effective strategies for monitoring SLC25A3 expression and localization?

Monitoring SLC25A3 expression and localization requires specific techniques tailored to this mitochondrial protein:

  • Antibody selection: For immunodetection, researchers can use:

    • Commercial antibodies against SLC25A3

    • Custom antibodies against specific peptides, such as a rabbit polyclonal antibody raised against the KLH-conjugated SLC25A3 peptide CRMQVDPQKYKGIFNGSVTLKED

    • Controls should include antibodies against other mitochondrial proteins (such as TOM40) to verify mitochondrial isolation quality

  • Subcellular fractionation: Isolation of intact mitochondria is essential for studying SLC25A3 localization. Standard protocols for mitochondrial isolation from cultured cells or tissues should be employed, followed by confirmation of fraction purity.

  • Confocal microscopy: For visualization of SLC25A3 localization, confocal microscopy with appropriate mitochondrial markers (such as MitoTracker dyes) and immunofluorescence against SLC25A3 can reveal its mitochondrial membrane distribution.

  • Protein tagging approaches: When studying recombinant SLC25A3, fusion with fluorescent proteins (GFP, mCherry) or epitope tags (FLAG, HA) can facilitate detection, though care must be taken to ensure tags don't interfere with mitochondrial targeting or function.

  • Verification of mitochondrial targeting: When expressing recombinant SLC25A3 variants, proper mitochondrial localization should be confirmed through immunoblot analysis of mitochondrial fractions, as demonstrated for the L175A SLC25A3 variant .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.