Recombinant Pongo abelii Phosphatidylinositide phosphatase SAC1 (SACM1L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SACM1L; SAC1; Phosphatidylinositol-3-phosphatase SAC1; Phosphatidylinositol-4-phosphate phosphatase; Suppressor of actin mutations 1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-587
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MATAAYEQLKLHITPEKFYVEACDDGADDVLTIDRVSTEVTLAVKKDVPPSAVTRPIFGI LGTIHLVAGNYLIVITKKIKVGEFFSHVIWKATDFDVLSYKKTMLHLTDIQLQDNKTFLA MLNHVLNVDGFYFSTTYDLTHTLQRLSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQP EVHRFALPVLHGFITMHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVET EQIVHYNGSKASFVQTRGSIPVFWSQRPNLKYKPLPQISKVANHMDGFQRHFDSQVIIYG KQVIINLINQKGSEKPLEQTFATMVSSLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVA EMQDELSYFLVDSAGQVVANQEGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHV GQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTHLGLIMDGWNSMIR YYKNNFSDGFRQDSIDLFLGNYSVDELESHSPLSVPRDWKFLALPIIMVVAFSMCIICLL MAGDTWTETLAYVLFWGVASIGTFFIILYNGKDFVDAPRLVQKEKID
Uniprot No.

Target Background

Function

This phosphatidylinositide phosphatase catalyzes the hydrolysis of phosphatidylinositol 4-phosphate (PtdIns(4)P) and phosphatidylinositol 3-phosphate (PtdIns(3)P), exhibiting low activity towards phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2). Robust PtdIns(4)P phosphatase activity is observed when PtdIns(4)P binds in a 'cis' configuration within the cellular environment, with significantly reduced activity in a 'trans' configuration. PtdIns(4)P phosphatase activity (in the 'trans' configuration) is enhanced by the presence of PLEKHA3.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the cellular localization of SAC1/SACM1L?

SAC1 is an integral membrane protein primarily localized to the endoplasmic reticulum (ER) and Golgi apparatus. Immunofluorescence microscopy confirms that endogenous SAC1 demonstrates this dual localization pattern. Importantly, SAC1 does not specifically localize to ER-PM membrane contact sites (MCS) in resting cells, as demonstrated by colocalization studies with ER markers such as calreticulin and Sec61β rather than MCS markers like MAPPER, ORP5, and E-Syt2 . This localization is critical for its function as a phosphatidylinositide phosphatase that regulates phosphoinositide homeostasis within these compartments.

What are the primary substrate specificities of SAC1/SACM1L?

SAC1 primarily functions as a phosphoinositide phosphatase with specificity for PtdIns4P (phosphatidylinositol 4-phosphate). Human SAC1 (hSAC1) demonstrates substrate specificity similar to its yeast ortholog (ySac1p) . SAC1 preferentially acts in a "cis" configuration, meaning it dephosphorylates PtdIns4P substrate present in the same membrane where the enzyme is anchored, rather than reaching across membrane gaps in a "trans" configuration . This substrate preference is essential for understanding experimental design when working with recombinant SAC1 proteins.

What are the key structural domains of SAC1/SACM1L?

SAC1 contains several functionally important domains:

  • An N-terminal catalytic domain responsible for phosphatase activity

  • A ~70 amino acid region between the catalytic domain and the transmembrane domain (TMD) essential for substrate recognition and catalysis

  • A C-terminal transmembrane domain that anchors the protein to the ER/Golgi membranes

  • A C-terminal KXKXX motif that mediates interaction with the COPI complex

Mutation studies have demonstrated that the region between residues 452–587 (including both the 70 amino acid region and the TMD) is critical for substrate recognition and enzymatic function . Without this region, the protein lacks phosphatase activity even when properly localized.

How does SAC1/SACM1L function in cellular autophagy pathways?

SAC1 plays a crucial role in xenophagy - the selective autophagic degradation of intracellular bacteria. Knockout studies of the SACM1L gene in HeLa cells demonstrate that SAC1 restricts intracellular bacterial replication by controlling PI(4)P on Salmonella-containing autophagosomes . Specifically:

  • SAC1 promotes fusion of Salmonella-containing autophagosomes with lysosomes

  • Loss of SAC1 reduces delivery of lysosomal enzymes to Salmonella-containing autophagosomes

  • In SACM1L knockout cells, the percentage of metabolically active Salmonella within LC3+ autophagosomes is higher than in wild-type cells

Quantitative assays reveal that by 2 hours post-infection, wild-type cells show 21% of bacteria in LC3+/pepstatin A+ compartments (indicating successful lysosomal fusion), while SACM1L knockout cells show only 14% . These findings indicate that SAC1's phosphatase activity is essential for proper maturation of autophagosomes and their subsequent fusion with lysosomes.

What protein interaction partners are critical for SAC1/SACM1L function?

One of the most significant interaction partners of SAC1 is the coatomer I (COPI) complex. This interaction is mediated through a KXKXX motif at the C-terminus of hSAC1 . Mutation of this motif abolishes interaction with COPI and causes accumulation of hSAC1 in the Golgi apparatus rather than maintaining its normal distribution between the ER and Golgi.

Interestingly, catalytically inactive SAC1 mutants also fail to interact with COPI despite having an intact KXKXX motif . This suggests a functional relationship between SAC1's enzymatic activity and its ability to engage with transport machinery, potentially indicating that the enzymatic function provides a conformational switch affecting accessibility of the COPI interaction motif.

Protein StateCOPI InteractionCellular Localization
Wild-type SAC1YesER and Golgi distributed
KXKXX motif mutantNoGolgi accumulation
Catalytically inactive mutantNoGolgi accumulation

What are the optimal expression systems for recombinant SAC1/SACM1L studies?

For functional studies of SAC1/SACM1L, mammalian expression systems such as COS-7 or HeLa cells have proven effective for both localization and functional studies. When expressing SAC1, consider the following:

  • GFP-tagged SAC1 exhibits identical localization to endogenous protein, making it suitable for microscopy studies

  • For studies requiring protein manipulation, FKBP-tagged SAC1 constructs enable inducible recruitment to specific membrane compartments

  • For biochemical studies requiring purified protein, E. coli expression systems can be used, though care must be taken with proper folding of the catalytic domain

When designing SAC1 constructs for functional studies, it's critical to maintain the ~70 amino acid region between the catalytic domain and TMD, as truncations removing residues 452-587 result in catalytically inactive protein despite proper localization .

How should researchers design experiments to investigate the "cis" versus "trans" activity of SAC1/SACM1L?

To investigate whether SAC1 acts in "cis" (same membrane) or "trans" (across membrane gaps), several experimental approaches have proven valuable:

  • Chimeric linker constructs: Generate FKBP-SAC1 chimeras containing helical linker sequences (EAAAR repeats) between the catalytic domain and TMD. Each (EAAAR)₂₋₁₀ repeat extends the reach of the catalytic domain by approximately 1.5-7.5 nm .

  • Artificial tethering to membrane contact sites: Using FKBP-FRB dimerization systems to recruit SAC1 to specific membrane domains.

  • Quantitative assessment of PtdIns4P degradation: Monitor PtdIns4P levels using fluorescent biosensors before and after SAC1 recruitment to membranes.

Research has demonstrated that native SAC1 has a "reach" of approximately 7 nm, making it insufficient to bridge the 15-25 nm gaps at natural ER-PM membrane contact sites . Only by artificially extending the linker between the TMD and catalytic domain by ~6 nm could significant "trans" activity be observed.

What methodologies are most effective for monitoring SAC1/SACM1L activity?

Several complementary approaches can be employed to monitor SAC1 activity:

  • Phosphoinositide biosensors: Fluorescent proteins fused to phosphoinositide-binding domains (especially PtdIns4P-binding domains) can track phosphatase activity in live cells.

  • Biochemical phosphatase assays: Using purified protein with artificial phosphoinositide substrates to measure phosphate release.

  • Functional readouts in autophagy: For studies focused on SAC1's role in autophagy, researchers can assess:

    • LC3I to LC3II conversion ratio via immunoblotting

    • Fluorescent reporter systems like mCherry-GFP-LC3 to track autophagosome maturation

    • Cathepsin activity assays using BODIPY FL-pepstatin A, MagicRed, or DQ-BSA to assess lysosomal fusion

When studying SAC1's role in bacterial autophagy, quantifying the percentage of LC3+, LAMP1+, and pepstatin A+ bacteria provides robust metrics of autophagic progression .

How can researchers distinguish between SAC1/SACM1L direct effects and secondary consequences?

Distinguishing direct SAC1 effects from secondary consequences requires careful experimental design:

  • Use of catalytically inactive mutants: Generate phosphatase-dead SAC1 mutants that maintain proper folding and lipid binding capacity but lack enzymatic activity .

  • Acute versus chronic depletion: Compare acute depletion (using inducible systems) with chronic knockout to separate immediate phosphatase activity effects from adaptive responses.

  • Substrate specificity controls: Monitor multiple phosphoinositide species simultaneously to confirm specificity of observed changes.

  • Rescue experiments: Perform complementation studies with wild-type versus mutant SAC1 in knockout backgrounds to confirm phenotype specificity.

For autophagy studies, it's particularly important to assess whether SAC1 affects general autophagy or specifically xenophagy. Research has shown that SACM1L knockout cells show normal basal and non-selective autophagy, normal autophagosome maturation, and normal lysosomal function, while specifically showing defects in autophagic clearance of bacteria .

What are the common pitfalls when working with recombinant SAC1/SACM1L proteins?

Researchers commonly encounter several challenges when working with recombinant SAC1:

  • Membrane protein purification issues: The transmembrane domain can complicate purification procedures, potentially requiring detergent solubilization that might affect activity.

  • Substrate presentation artifacts: In vitro phosphatase assays may not accurately recapitulate the membrane environment where SAC1 normally functions.

  • Overexpression artifacts: Excessive SAC1 expression can disrupt ER/Golgi architecture, particularly in the trans-Golgi network, which appears dispersed in SAC1 knockout or overexpression systems .

  • Difficulties distinguishing between SAC1 localization effects versus catalytic effects: Since both mutation of the COPI interaction motif and catalytic inactivation cause Golgi accumulation, determining whether a phenotype is due to mislocalization or lack of enzymatic activity requires careful controls .

How might studying evolutionary conservation between Pongo abelii SAC1 and human SAC1 inform functional research?

While most research has focused on human and yeast SAC1, comparative studies with Pongo abelii (orangutan) SAC1 could provide valuable evolutionary insights:

  • Determine conservation of key functional domains (catalytic site, COPI interaction motif)

  • Compare substrate specificities between primate orthologs

  • Investigate whether species-specific differences exist in interaction partners

Such comparative studies could identify evolutionarily conserved versus species-specific functions, potentially highlighting the most fundamental aspects of SAC1 biology.

What remains unclear about the mechanisms linking SAC1/SACM1L phosphatase activity to autophagosome maturation?

Several key questions remain regarding how SAC1's phosphatase activity mechanistically controls autophagosome maturation:

  • How does PI(4)P regulation specifically affect autophagosome-lysosome fusion machinery?

  • Are there direct interactions between SAC1 and autophagy proteins?

  • Does SAC1 regulate membrane fusion directly or through recruitment of fusion machinery?

Current research indicates that SAC1 loss reduces the delivery of lysosomal enzymes to Salmonella-containing autophagosomes, but the precise molecular mechanisms linking phosphoinositide metabolism to fusion machinery recruitment remain to be fully elucidated .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.