Recombinant Pongo abelii Potassium voltage-gated channel subfamily S member 1 (KCNS1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will then prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development according to your specifications.
Synonyms
KCNS1; Potassium voltage-gated channel subfamily S member 1; Delayed-rectifier K(+ channel alpha subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-526
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
KCNS1
Target Protein Sequence
MLMLLVRGTHYENLRPKVVLPTPLVGRSTETFVSEFPGPDTGIRWRRSDEALRVNVGGVR RQLSARALARFPGTRLGRLQAAASEEQARRLCDDYDEAAREFYFDRHPGFFLGLLHFYRT GHLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRLTQPHAWDEDSDTPSSVDPC PDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIH SLPEYQAREAAAAVAAVAAGRSPEGVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF FCHPLNLIDIVSVLPFYLTLLAGVALGDQGGKEFGHLGKVVQVFRLMRIFRVLKLARHST GLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFNTIPACWWWGTVSMT TVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNSNHR EFEDLLSSVDGVSEASLETSRETSQEGRSADLESQAPSEPPHPQMY
Uniprot No.

Target Background

Function
Potassium channel subunit that does not form functional channels on its own. It can form functional heterotetrameric channels in conjunction with KCNB1 and KCNB2, modulating the activation and deactivation rates of the delayed rectifier voltage-gated potassium channel of KCNB1 and KCNB2.
Database Links
Protein Families
Potassium channel family, S (TC 1.A.1.2) subfamily, Kv9.1/KCNS1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is KCNS1 and what is its function in neuronal systems?

KCNS1 encodes the potassium voltage-gated channel subfamily S member 1, also known as delayed-rectifier K(+) channel alpha subunit 1. This protein functions as a critical component in the regulation of neuronal excitability by mediating potassium ion flow across cell membranes. In neuronal systems, KCNS1 plays a significant role in determining the threshold and characteristics of cell activation, particularly in pain-signaling neurons . The channel contributes to the repolarization phase of action potentials, thereby controlling the frequency and pattern of neuronal firing. Proper function of these channels maintains normal pain sensitivity, while dysregulation may lead to hyperexcitability associated with chronic pain conditions .

How does the Pongo abelii KCNS1 compare to human KCNS1?

The Pongo abelii (Sumatran orangutan) KCNS1 shares significant homology with human KCNS1, making it valuable for comparative studies in pain research and neurobiology. The recombinant protein features a full-length sequence of 526 amino acids as indicated in product specifications . The amino acid sequence includes conserved domains critical for voltage sensing and ion conduction that are highly preserved across species. This conservation facilitates translational research where findings in non-human primate models may have implications for human physiology and pathology. The protein has been assigned UniProt accession number A4K2V2, which researchers can reference for detailed sequence information and evolutionary analysis .

What experimental approaches are recommended for studying KCNS1 function?

For studying KCNS1 function, several methodological approaches are recommended:

  • Electrophysiology: Patch-clamp recordings provide direct measurement of channel activity and kinetics. Whole-cell or single-channel recordings can be employed to assess voltage dependence, activation/inactivation characteristics, and pharmacological responses.

  • Expression systems: Heterologous expression in systems such as Xenopus oocytes or mammalian cell lines (HEK293, CHO) allows for isolation of channel function from confounding variables.

  • Gene modification techniques: CRISPR/Cas9-mediated editing can be used to introduce specific mutations or create knockout models to examine functional consequences.

  • Calcium imaging: Since potassium channel activity influences calcium influx indirectly, calcium imaging can serve as a proxy for channel function in certain experimental paradigms.

When working with the recombinant protein, researchers should reconstitute it in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage stability . For functional studies, the reconstituted protein must be integrated into appropriate membrane systems or used in binding assays with interaction partners.

How do polymorphisms in KCNS1 influence chronic pain mechanisms and treatment outcomes?

Research has identified a significant relationship between KCNS1 genetic variations and chronic pain phenotypes. A common single nucleotide polymorphism (SNP) in the KCNS1 gene correlates with pain sensitivity and chronification. In a study involving 201 participants with chronic musculoskeletal pain, genotypic differences produced distinct pain phenotypes :

GenotypePain ExperiencePsychological FactorsResponse to Treatment
Val/Val homozygousLower total pain experienceReduced catastrophizing, greater mental functioningModerate improvement in both physical and psychological domains
Val/Ile heterozygousIntermediate pain experienceIntermediate psychological impactGreater improvement in physical domains
Ile/Ile homozygousHigher total pain experienceHigher catastrophizing, lower mental functioningGreater improvement in psychological domains

The KCNS1 polymorphism appears to modulate pain processing by altering neuronal excitability. At a molecular level, these genetic variations likely affect the voltage dependence or kinetics of the channel, resulting in altered firing patterns in pain-signaling neurons. This, in turn, influences both the perception of pain and the psychological response to chronic pain states .

Interestingly, the study demonstrated that while baseline pain experiences differed by genotype, all participants achieved similar levels of physical and psychological functioning after treatment, regardless of genotype. Treatment efficacy showed genotype-specific patterns, with cognitive behavioral therapy (CBT) generally outperforming educational interventions (EDU) across all genotypes .

What are the challenges in producing functional recombinant KCNS1 for in vitro studies?

Producing functional recombinant KCNS1 for in vitro studies presents several significant challenges:

  • Proper folding and post-translational modifications: Potassium channels require specific folding patterns and post-translational modifications to achieve proper function. Expression systems must be selected carefully to ensure these processes occur correctly. Yeast expression systems have been used successfully for KCNS1 production, as indicated in product specifications .

  • Membrane integration: As an integral membrane protein, KCNS1 requires a lipid environment for proper function. Researchers must develop strategies for efficient membrane insertion during reconstitution experiments.

  • Protein stability: The recombinant protein has limited stability, with liquid forms having a shelf life of approximately 6 months at -20°C/-80°C. Repeated freeze-thaw cycles significantly reduce activity, necessitating careful aliquoting and storage protocols .

  • Association with regulatory subunits: In vivo, KCNS1 typically associates with other channel subunits to form functional complexes. Researchers must consider whether to co-express these partners or study KCNS1 in isolation, recognizing the limitations of each approach.

  • Verification of functionality: Confirming that the recombinant protein exhibits native-like electrophysiological properties requires specialized equipment and expertise. Researchers should implement quality control measures such as SDS-PAGE (>85% purity expected) and functional assays to validate their preparations .

How can researchers effectively design studies to investigate KCNS1 involvement in neuropathic versus musculoskeletal pain?

Designing effective studies to differentiate KCNS1's role in neuropathic versus musculoskeletal pain requires a multifaceted approach:

  • Subject selection and phenotyping:

    • Implement rigorous inclusion/exclusion criteria to clearly distinguish between neuropathic and musculoskeletal pain conditions

    • Use validated assessment tools (e.g., DN4, painDETECT for neuropathic pain; WOMAC for musculoskeletal pain)

    • Collect comprehensive clinical data including pain duration, intensity, quality, and distribution

  • Genetic analysis:

    • Sequence the KCNS1 gene to identify relevant polymorphisms, particularly the Val/Ile SNP identified in previous research

    • Consider analyzing multiple genes involved in pain processing to account for genetic interactions

    • Use appropriate controls matched for age, sex, and ethnicity to minimize confounding factors

  • Functional assessments:

    • Quantify sensory thresholds using standardized quantitative sensory testing (QST) protocols

    • Assess response to specific stimuli (mechanical, thermal, chemical) that activate different nociceptive pathways

    • Measure pain-related psychological variables (catastrophizing, fear-avoidance beliefs) using validated instruments

  • Mechanistic investigations:

    • Employ electrophysiological techniques to assess channel function in animal models or human tissues

    • Consider using induced pluripotent stem cells (iPSCs) differentiated into nociceptors to study genotype-specific responses

    • Utilize pharmacological probes selective for potassium channels to assess functional consequences of KCNS1 variants

  • Longitudinal design:

    • Track pain trajectories over time to differentiate acute from chronic mechanisms

    • Assess treatment responses based on genotype, as done in the study examining CBT versus EDU interventions

    • Consider environmental factors and their interaction with KCNS1 genotype

What are the optimal storage and handling protocols for recombinant KCNS1 to maintain its biological activity?

To maintain optimal biological activity of recombinant KCNS1, researchers should adhere to the following storage and handling protocols:

  • Initial processing:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (with 50% being recommended for longest stability)

  • Storage conditions:

    • For short-term storage (up to one week), store working aliquots at 4°C

    • For medium-term storage (up to 6 months), maintain liquid preparations at -20°C

    • For long-term storage (up to 12 months), store lyophilized preparations at -20°C or preferably -80°C

  • Aliquoting strategy:

    • Divide reconstituted protein into single-use aliquots to prevent repeated freeze-thaw cycles

    • Use small volume aliquots appropriate for experimental needs

    • Label clearly with reconstitution date and concentration

  • Thawing procedure:

    • Thaw frozen aliquots rapidly at room temperature followed by placement on ice

    • Use thawed protein immediately for optimal activity

    • Never refreeze thawed aliquots as repeated freeze-thawing significantly reduces activity

  • Quality control:

    • Periodically verify protein integrity using SDS-PAGE (expect >85% purity)

    • For functional studies, validate activity using appropriate assays before conducting critical experiments

    • Consider including positive controls in experiments to confirm assay performance

How can researchers effectively integrate KCNS1 genetic data with clinical pain assessments in study designs?

Effective integration of KCNS1 genetic data with clinical pain assessments requires careful methodological planning:

  • Standardized genetic sampling:

    • Collect DNA samples using consistent methods (blood, saliva, or buccal swabs)

    • Process and store samples according to established protocols to ensure DNA quality

    • Use validated genotyping techniques with appropriate controls to ensure accuracy

  • Comprehensive phenotyping:

    • Employ multidimensional pain assessments that capture sensory, affective, and cognitive dimensions

    • Include both patient-reported outcomes and objective measures

    • Use standardized instruments with established psychometric properties

  • Study design considerations:

    • Calculate appropriate sample sizes based on expected effect sizes from previous studies

    • Consider structured nested designs that allow for analysis of genetic subgroups

    • Control for potential confounding variables (age, sex, ethnicity, comorbidities)

  • Statistical approaches:

    • Employ mixed-effects models to account for within-subject correlations in longitudinal data

    • Consider gene-environment interaction analyses

    • Use appropriate corrections for multiple testing when examining various pain outcomes

  • Integration framework:

    • Develop a priori hypotheses about relationships between specific genotypes and pain phenotypes

    • Create integrated databases that link genetic, clinical, and psychosocial variables

    • Consider machine learning approaches for identifying complex patterns in integrated datasets

The study by Atkinson demonstrated this integration by correlating KCNS1 genotypes with baseline pain measures and treatment outcomes. Their approach included genotyping participants, administering questionnaires measuring physical pain symptoms and psychological suffering at baseline, and then reassessing after three months of treatment .

What electrophysiological protocols are most suitable for characterizing KCNS1 channel properties in different experimental systems?

For comprehensive characterization of KCNS1 channel properties, researchers should consider these electrophysiological protocols:

  • Whole-cell patch-clamp recordings:

    • Voltage-step protocols: Apply steps from -100 mV to +60 mV in 10 mV increments to generate current-voltage relationships

    • Steady-state inactivation: Hold at various potentials before stepping to test potential

    • Recovery from inactivation: Apply paired pulses with varying interpulse intervals

    • Recording solutions should contain (in mM): extracellular - 140 NaCl, 5 KCl, 2 CaCl₂, 1 MgCl₂, 10 HEPES, 10 glucose (pH 7.4); intracellular - 140 KCl, 1 MgCl₂, 10 HEPES, 10 EGTA, 4 ATP-Mg (pH 7.2)

  • Single-channel recordings:

    • Cell-attached or inside-out patch configurations for examining channel kinetics

    • Analysis of open probability, conductance, and mean open/closed times

    • Pharmacological manipulation to assess channel modulation

  • Heterologous expression systems:

    • HEK293 or CHO cells for mammalian expression

    • Xenopus oocytes for two-electrode voltage clamp

    • Co-expression with modulatory subunits to study native-like channel complexes

  • Primary neuronal cultures:

    • Dissociated DRG neurons for studying native channel properties

    • Current-clamp recordings to assess impact on action potential properties

    • Calcium imaging as a complementary approach to electrophysiology

  • Analysis parameters:

    • Activation kinetics: Time constants for reaching peak current

    • Deactivation kinetics: Time constants for current decay upon repolarization

    • Voltage dependence: Half-activation and half-inactivation voltages (V½)

    • Slope factors (k) for activation and inactivation curves

    • Single-channel conductance and open probability

How should researchers interpret differences in KCNS1 genotype effects across different pain conditions?

Interpreting differences in KCNS1 genotype effects across pain conditions requires nuanced analysis and consideration of multiple factors:

  • Context-dependent effects:

    • Different pain conditions involve distinct pathophysiological mechanisms that may interact differently with KCNS1 function

    • The same genotype may produce opposite effects depending on the underlying pathology

    • Consider the interaction between KCNS1 and other ion channels specific to each condition

  • Analytical framework:

    • Employ stratified analyses to examine genotype effects within specific pain conditions

    • Use interaction terms in statistical models to quantify differential effects

    • Consider Bayesian approaches to account for prior knowledge about condition-specific mechanisms

  • Genetic background considerations:

    • Evaluate the influence of other genetic factors that may modulate KCNS1 effects

    • Consider ethnic differences in allele frequencies and haplotype structures

    • Examine gene-gene interactions that may be condition-specific

  • Phenotypic precision:

    • Distinguish between specific pain subtypes within broader categories (e.g., inflammatory vs. mechanical musculoskeletal pain)

    • Consider pain duration, severity, and quality as potential modifiers of genotype effects

    • Integrate quantitative sensory testing data to identify sensory phenotypes

Based on the available research, the Val/Ile KCNS1 polymorphism appears to have different effects in neuropathic versus musculoskeletal pain conditions. In neuropathic pain, the Val allele was associated with more severe symptoms in some studies, while in musculoskeletal pain, those homozygous for the Val mutation demonstrated reduced catastrophizing, lower total pain experience, and greater mental functioning compared to their Val/Ile and Ile/Ile counterparts . These differences may reflect condition-specific mechanisms through which KCNS1 function influences pain processing.

What statistical approaches are recommended for analyzing KCNS1 genetic associations with pain phenotypes in clinical studies?

For robust analysis of KCNS1 genetic associations with pain phenotypes, researchers should consider these statistical approaches:

  • Power analysis and sample size calculation:

    • Base calculations on expected effect sizes from previous studies

    • Account for allele frequencies in the population of interest

    • Consider stratified analyses when determining required sample sizes

  • Genotype-phenotype association testing:

    • Primary approach: Generalized linear models adjusting for relevant covariates

    • For continuous outcomes: Linear regression or ANOVA with appropriate post-hoc tests

    • For categorical outcomes: Logistic regression with odds ratios and confidence intervals

    • Consider dominant, recessive, and additive genetic models

  • Multiple testing corrections:

    • Bonferroni correction for independent tests

    • False Discovery Rate (FDR) methods for less conservative adjustment

    • Permutation testing to establish empirical p-values

  • Longitudinal data analysis:

    • Mixed-effects models to account for repeated measurements

    • Growth curve analysis to examine trajectories over time

    • Include treatment-by-genotype interaction terms to assess differential treatment effects

  • Advanced analytical approaches:

    • Mediation analysis to examine mechanisms through which genotype affects pain outcomes

    • Structural equation modeling for complex relationships between variables

    • Machine learning for identifying patterns in high-dimensional data

In the study examining KCNS1 effects on chronic musculoskeletal pain, researchers employed statistical approaches including ANOVA with appropriate post-hoc tests to compare baseline characteristics across genotypes, and mixed-effects models to analyze treatment responses over time, finding that genotypic variation significantly influenced both baseline pain experience and patterns of improvement with treatment .

How can researchers distinguish direct KCNS1 effects from indirect effects mediated through other ion channels or signaling pathways?

Distinguishing direct KCNS1 effects from indirect effects requires sophisticated experimental designs and analytical approaches:

  • Molecular interaction studies:

    • Co-immunoprecipitation to identify channel interactions

    • FRET or BRET to assess physical proximity of channel subunits

    • Yeast two-hybrid or mammalian two-hybrid assays to confirm protein-protein interactions

  • Channel modulation experiments:

    • Selective pharmacological tools targeting specific channels

    • Sequential blockade protocols to isolate channel contributions

    • Heterologous expression systems with controlled subunit composition

  • Genetic manipulation strategies:

    • RNA interference to selectively knockdown KCNS1 or interacting partners

    • CRISPR/Cas9 to introduce specific mutations or create knockout models

    • Rescue experiments to confirm specificity of observed effects

  • Pathway analysis approaches:

    • Phosphoproteomic analysis to identify altered signaling pathways

    • Calcium imaging to assess secondary effects on calcium-dependent processes

    • Transcriptomic profiling to identify downstream consequences of channel dysfunction

  • Computational modeling:

    • Develop biophysical models incorporating KCNS1 and interacting channels

    • Simulate effects of genetic variations on action potential properties

    • Predict consequences of altered channel function on neuronal excitability

Through careful experimental design and analysis, researchers can build evidence for direct versus indirect effects. For example, if a KCNS1 variant affects neuronal excitability even when other channels are blocked or in expression systems lacking interacting partners, this suggests a direct effect. Conversely, if effects disappear under these conditions, indirect mechanisms are more likely.

What emerging technologies may enhance our understanding of KCNS1 function in pain processing?

Several emerging technologies hold promise for advancing our understanding of KCNS1 function in pain processing:

  • Single-cell technologies:

    • Single-cell RNA sequencing to identify cell-specific expression patterns

    • Patch-seq combining electrophysiology with transcriptomic analysis

    • Mass cytometry to correlate channel expression with cellular phenotypes

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize channel localization and clustering

    • Optogenetic approaches to control channel function with light

    • Genetically encoded voltage indicators for non-invasive monitoring of neuronal activity

  • Human stem cell models:

    • Patient-derived iPSCs differentiated into nociceptors

    • Organoid models recapitulating complex tissue interactions

    • CRISPR-based genetic modification to create isogenic lines differing only in KCNS1 genotype

  • In vivo monitoring approaches:

    • Fiber photometry to record neural activity in awake, behaving animals

    • Wireless electrophysiology for long-term recording in naturalistic settings

    • Implantable biosensors for continuous monitoring of relevant biomarkers

  • Computational approaches:

    • Machine learning for pattern recognition in complex datasets

    • Systems biology models integrating multiple levels of biological organization

    • Virtual screening to identify novel channel modulators

These technologies can be applied to answer critical questions about KCNS1 function, such as its cell type-specific expression patterns, subcellular localization, interaction partners, and dynamic regulation in response to pain stimuli or therapeutic interventions.

How might pharmacological targeting of KCNS1 advance personalized pain management strategies?

Pharmacological targeting of KCNS1 presents significant opportunities for personalized pain management:

  • Genotype-guided therapy:

    • Development of modulators specific to particular KCNS1 variants

    • Clinical trials stratified by genotype to identify responder populations

    • Predictive biomarkers based on channel function to guide treatment selection

  • Precision targeting strategies:

    • Allosteric modulators that enhance or suppress channel function

    • Gene therapy approaches to correct dysfunctional variants

    • RNA-based therapies to modulate expression in specific tissues

  • Combination approaches:

    • Channel modulators paired with cognitive behavioral interventions

    • Multi-target strategies addressing complementary mechanisms

    • Temporally controlled delivery systems for context-specific modulation

  • Translational considerations:

    • Development of human biomarkers reflecting channel function

    • Surrogate endpoints for early clinical trials

    • Patient stratification tools for clinical implementation

The research demonstrating differential treatment responses based on KCNS1 genotype provides a foundation for personalized approaches . Patients with the Ile/Ile genotype showed greater improvement in psychological domains with treatment, while Val/Ile individuals improved more in physical domains. These findings suggest that treatment selection could potentially be optimized based on genotype, with some patients benefiting more from psychologically-oriented interventions and others from physically-focused treatments.

What interdisciplinary approaches could advance our understanding of KCNS1's role in pain chronification?

Advancing our understanding of KCNS1's role in pain chronification requires interdisciplinary collaboration:

  • Integrated basic and clinical research:

    • Translational models linking molecular mechanisms to clinical phenotypes

    • Reverse translation of clinical observations to targeted mechanistic studies

    • Biorepositories linking biological samples with detailed clinical data

  • Computational neuroscience approaches:

    • Network models of pain processing incorporating ion channel properties

    • Machine learning to identify patterns in heterogeneous datasets

    • Predictive modeling of chronification risk based on genetic and clinical factors

  • Systems biology framework:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

    • Pathway analysis to identify convergent mechanisms

    • Temporal profiling to capture dynamic changes during chronification

  • Psychological and social perspectives:

    • Integration of psychological factors that interact with biological mechanisms

    • Examination of social determinants that modify genetic effects

    • Development of biopsychosocial models specific to KCNS1-associated pain

  • Implementation science:

    • Strategies for translating genetic findings into clinical practice

    • Cost-effectiveness analyses of genotype-guided interventions

    • Educational approaches for patients and clinicians

The study examining KCNS1 effects on chronic musculoskeletal pain exemplifies this interdisciplinary approach, integrating genetic analysis, psychological assessment, and clinical interventions . This research demonstrated that KCNS1 genotypic variation alters not only the physical experience of pain but also psychological factors like catastrophizing and mental functioning, highlighting the importance of considering both biological and psychological dimensions in understanding pain chronification.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.