Recombinant Pongo abelii Potassium voltage-gated channel subfamily V member 1 (KCNV1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
All proteins are shipped with standard blue ice packs. For dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference for your own solutions.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. Lyophilized protein typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
KCNV1; Potassium voltage-gated channel subfamily V member 1; Voltage-gated potassium channel subunit Kv8.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-500
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
KCNV1
Target Protein Sequence
MPSSGRALLDSPLDSGSLTSLDSSVFCSEGEGEPLALGDCFTVNVGGSRFVLSQQALSCF PHTRLGKLAVVVASYRRPGALAAVPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYYRTG RLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTEDQESQHES EQDFSQGPCPTVRQKLWNILEKPGSSTAARIFGVISIIFVVVSIINMALMSAELSWLDLQ LLEILEYVCISWFTGEFVLRFLCVRDRCRFLRKVPNIIDLLAILPFYITLLVESLSGSQT TQELENVGRIVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGISIF STVEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGILVL ALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIMEML RLKGRERASTRSSGGDDFWF
Uniprot No.

Target Background

Function
Potassium channel subunit that does not form functional channels independently. It modulates the activity of KCNB1 and KCNB2 channels by shifting the inactivation threshold to more negative values and slowing the inactivation rate. It can downregulate the channel activity of KCNB1, KCNB2, KCNC4, and KCND1, potentially by trapping them in intracellular membranes.
Database Links
Protein Families
Potassium channel family, V (TC 1.A.1.2) subfamily, Kv8.1/KCNV1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does KCNV1 function in neuronal systems?

KCNV1 (also known as Kv8.1) does not form functional channels by itself but acts as a modulator of other potassium channels. Specifically:

  • It forms heteromeric channels with members of the Kv2 subfamily

  • It shifts the threshold for inactivation to more negative values

  • It slows the rate of inactivation when co-expressed with Kv2 channels

  • It down-regulates channel activity of KCNB1, KCNB2, KCNC4, and KCND1, possibly by trapping them in intracellular membranes

This modulatory function is critical for regulating neuronal excitability, particularly in brain regions where KCNV1 is primarily expressed. The protein's inability to function as an independent channel but its ability to modulate other channels indicates its role as a regulatory component in neuronal excitability rather than a primary conductor of potassium ions .

What are the recommended storage and handling conditions for recombinant Pongo abelii KCNV1 protein?

For optimal stability and activity of recombinant Pongo abelii KCNV1:

ParameterRecommendation
Storage BufferTris-based buffer with 50% glycerol, optimized for KCNV1 protein
Short-term Storage4°C for up to one week for working aliquots
Long-term Storage-20°C (standard) or -80°C (extended storage)
Freeze/Thaw CyclesMinimize; repeated freezing and thawing is not recommended
Quantity AvailableTypically 50 µg, with other quantities available upon request

When handling the protein, maintain sterile conditions and avoid contamination to preserve functional integrity. For experimental use, it is advisable to make small working aliquots to prevent repeated freeze-thaw cycles that can compromise protein function .

What experimental approaches are most effective for studying KCNV1 functional modulation of other potassium channels?

To effectively investigate KCNV1's modulatory effects on other potassium channels, researchers should consider the following methodological approaches:

  • Electrophysiological studies: Using patch-clamp techniques in heterologous expression systems (such as Xenopus oocytes or HEK293 cells) to measure:

    • Channel kinetics in the presence/absence of KCNV1

    • Shifts in voltage-dependence of activation/inactivation

    • Changes in current amplitude

  • Co-immunoprecipitation assays: To verify physical interaction between KCNV1 and target potassium channels like KCNB1 and KCNB2.

  • Fluorescent protein tagging and microscopy: To visualize subcellular localization of channel complexes and determine if KCNV1 alters trafficking of other potassium channels.

  • Site-directed mutagenesis: To identify critical residues in KCNV1 responsible for interaction with and modulation of other channel subunits.

What is the relationship between KCNV1 expression and neurological disorders in primates?

The relationship between KCNV1 and neurological disorders represents an important research area based on several lines of evidence:

  • Epilepsy connection: Human KCNV1 maps to chromosome 8q23.3, a locus for benign adult familial myoclonic epilepsy. The protein's role in modulating neuronal excitability through interaction with other potassium channels makes it a candidate gene for epileptic disorders .

  • Schizophrenia association: KCNV1 has been identified among potassium channel genes (including KCNB1, KCNG2, KCNQ1, KCNQ5, and KCNV1) supported by both common variation and expression data as potentially involved in schizophrenia pathophysiology .

  • Comparative neurobiology: Studying KCNV1 in Pongo abelii provides an opportunity for comparative analysis of channel function across primates, potentially revealing evolutionary adaptations in brain function.

Research approaches should include:

  • Comparative gene expression analyses across brain regions in different primate species

  • Functional characterization of species-specific variations in the KCNV1 protein

  • Investigation of convergent molecular pathways between KCNV1 and other neurological risk genes

While direct evidence linking Pongo abelii KCNV1 specifically to neurological disorders is limited, the high conservation of potassium channel function across species suggests similar pathophysiological mechanisms may be involved .

How can promoter analysis of KCNV1 inform our understanding of its expression regulation?

Promoter analysis of KCNV1 provides critical insights into its transcriptional regulation:

  • Identified regulatory elements: Studies of the KCNV1 promoter have identified:

    • Three Sp1 motifs active in the core promoter sequence (spanning nt -1350 to -911, with ATG initiation codon counted as +1)

    • At least two additional essential elements for promoter activity

    • A possible alternative 3' end located 280 bp downstream from the initially reported 3' end

  • Experimental approach for promoter characterization:

    • Generate deletion and random mutants of the promoter region

    • Examine promoter activities using luciferase reporter systems

    • Perform in silico analysis to detect regulatory motifs

  • Functional implications: Understanding KCNV1 promoter function enables:

    • Identification of transcription factors that regulate KCNV1 expression

    • Insight into tissue-specific expression patterns in the brain

    • Development of experimental tools to modulate KCNV1 expression for functional studies

Research suggests that the promoter structure of KCNV1 may contribute to its brain-specific expression pattern, which is critical for its role in modulating neuronal excitability .

What are the challenges in distinguishing the functional properties of KCNV1 from other potassium channel subfamilies in neuronal systems?

Researchers face several methodological challenges when studying KCNV1 function:

  • Overlapping expression patterns: Multiple potassium channel subfamilies (Kv1-Kv9) are expressed in the same neuronal populations, making it difficult to isolate KCNV1-specific effects. This requires:

    • Single-cell expression profiling techniques

    • Selective pharmacological tools or highly specific antibodies

    • Precise genetic manipulation (e.g., CRISPR-Cas9) to target KCNV1 specifically

  • Heteromeric channel formation: KCNV1 forms heteromeric channels with other Kv subunits, particularly from the Kv2 subfamily. Researchers must employ:

    • Dominant-negative constructs

    • Subunit-specific tagging strategies

    • Advanced biophysical techniques to distinguish channel properties

  • Modulatory versus direct channel functions: Unlike typical potassium channels, KCNV1 primarily functions as a modulator rather than an independent channel, requiring:

    • Sophisticated electrophysiological protocols to detect modulatory effects

    • Analysis of shifts in biophysical properties rather than direct currents

    • Experiments designed to capture regulatory effects on other channels' trafficking and membrane expression

A comprehensive approach using multiple methodologies is essential for distinguishing KCNV1's unique contributions to neuronal function from those of other potassium channel subfamilies.

What are the optimal expression systems for recombinant production of functional Pongo abelii KCNV1?

The choice of expression system significantly impacts the yield and functional properties of recombinant KCNV1:

Expression SystemAdvantagesLimitationsBest Applications
E. coli- High yield
- Cost-effective
- Rapid production
- Lacks post-translational modifications
- May form inclusion bodies requiring refolding
- No glycosylation
- Structural studies
- Antibody production
- Protein interaction assays
Yeast- Post-translational modifications
- Higher protein folding fidelity
- Moderate cost
- Glycosylation patterns differ from mammals
- Lower yield than E. coli
- Functional studies requiring basic post-translational modifications
- Protein-protein interaction studies
Baculovirus/Insect cells- Near-native post-translational modifications
- Good for membrane proteins
- High expression levels
- More expensive than bacterial/yeast systems
- Longer production time
- Functional studies
- Electrophysiological characterization
Mammalian cells- Native-like post-translational modifications
- Proper protein folding
- Authentic subcellular targeting
- Most expensive system
- Lower yields
- Technical complexity
- Functional studies requiring authentic channel properties
- Cell biological studies of trafficking and localization

For studies focusing on the modulatory effects of KCNV1 on other potassium channels, mammalian expression systems (particularly neuronal cell lines or primary neurons) are recommended despite their higher cost and complexity. These systems provide the most relevant cellular context for studying KCNV1's interactions with other channel subunits and its effects on channel trafficking .

What experimental protocols are recommended for analyzing KCNV1 interactions with Kv2 and Kv3 family members?

For analyzing KCNV1 interactions with Kv2 and Kv3 family members, the following experimental protocols are recommended:

  • Co-expression and electrophysiology:

    • Co-express KCNV1 with Kv2.1, Kv2.2, or Kv3 subunits in Xenopus oocytes or mammalian cells

    • Apply voltage-step protocols to characterize:

      • Activation kinetics (time to peak current)

      • Inactivation parameters (steady-state inactivation curves)

      • Recovery from inactivation

      • Current amplitude and voltage dependence

    • Compare results with cells expressing only Kv2/Kv3 channels without KCNV1

  • Biochemical interaction assays:

    • Co-immunoprecipitation of tagged KCNV1 with Kv2/Kv3 subunits

    • Proximity ligation assays to detect protein-protein interactions in situ

    • FRET or BiFC (Bimolecular Fluorescence Complementation) to visualize direct interactions

  • Trafficking and localization studies:

    • Immunocytochemistry with confocal microscopy to assess co-localization

    • Surface biotinylation assays to quantify membrane expression

    • TIRF microscopy to visualize channel complexes at the membrane

  • Domain mapping:

    • Generate chimeric constructs between KCNV1 and related subunits

    • Use truncation mutants to identify interaction domains

    • Perform alanine scanning mutagenesis of key residues

Research has shown that KCNV1 does not display K+ channel activity when expressed alone, but instead inhibits the activity of Kv2 and Kv3 channels through these interactions .

How can researchers effectively compare KCNV1 function across different primate species?

To effectively compare KCNV1 function across different primate species:

  • Sequence and structural analysis:

    • Perform multiple sequence alignments of KCNV1 from different primates (human, Pongo abelii, other great apes, and non-human primates)

    • Identify conserved domains and species-specific variations

    • Use homology modeling to predict structural differences

  • Comparative expression profiling:

    • Analyze tissue-specific expression patterns across species using RNAseq data

    • Compare developmental expression trajectories

    • Examine species differences in splicing patterns

    • Use brain atlas data to map expression in homologous brain regions

  • Functional comparison:

    • Express KCNV1 from different species in the same experimental system

    • Measure modulatory effects on standardized Kv2/Kv3 channels

    • Compare biophysical parameters including:

      • Voltage dependence of activation/inactivation

      • Kinetics of channel opening/closing

      • Trafficking efficiency

      • Protein stability and turnover

  • Evolutionary analysis:

    • Calculate selection pressures (dN/dS ratios) acting on KCNV1 across the primate phylogeny

    • Identify sites under positive selection that might relate to species-specific functional adaptations

    • Correlate molecular evolution with brain size, cognitive complexity, or specific neurological adaptations

This comparative approach provides insights into the evolutionary conservation and divergence of KCNV1 function, potentially revealing adaptations related to species-specific neurophysiology or disease susceptibility .

How should researchers interpret differences between in vitro and in vivo findings related to KCNV1 function?

When reconciling differences between in vitro and in vivo findings:

  • Contextual factors to consider:

    • Complex cellular environment: In vivo systems contain the full complement of regulatory proteins, signaling pathways, and interacting partners that may be absent in vitro.

    • Developmental regulation: KCNV1 expression and function may be temporally regulated during development, affecting interpretation of findings from adult versus developing systems.

    • Region-specific effects: KCNV1 may function differently in various brain regions due to varying expression of interacting partners.

    • Network effects: Changes in KCNV1 function can have cascading effects on neural circuit activity that are not observable in isolated cell systems.

  • Methodological approach for reconciliation:

    • Begin with simplified in vitro systems to establish basic molecular mechanisms

    • Progressively increase system complexity (cell lines → primary neurons → brain slices → in vivo)

    • Validate key findings across multiple experimental approaches

    • Use computational modeling to bridge gaps between scales of analysis

  • Case example: Studies of KCNV1 have shown that it does not display K+ channel activity when expressed alone in Xenopus oocytes (in vitro), but it plays important roles in neurological conditions like epilepsy and schizophrenia (in vivo correlation). This apparent contradiction is resolved by understanding KCNV1's role as a modulator of other channels rather than as an independent channel .

What genomic and proteomic datasets are most valuable for contextualizing KCNV1 research findings?

Researchers should leverage the following datasets to contextualize KCNV1 findings:

  • Species-specific genomic resources:

    • Pongo abelii genome sequence data (available through NCBI and Ensembl)

    • Comparative genomic datasets across primates to analyze evolutionary conservation

    • Population-level variation data to identify natural polymorphisms

  • Transcriptomic resources:

    • Brain region-specific expression atlases (e.g., Allen Brain Atlas)

    • Single-cell RNAseq datasets to identify cell-type specific expression

    • Developmental transcriptome projects to map temporal expression patterns

  • Proteomic databases:

    • The Human Protein Atlas for tissue-specific expression patterns

    • Protein-protein interaction databases (e.g., STRING, BioGRID)

    • Post-translational modification databases

  • Disease-association resources:

    • Genome-wide association studies for epilepsy, schizophrenia, and other neurological disorders

    • Copy number variation databases

    • Genetic variation catalogs from clinical sequencing initiatives

  • Functional genomics datasets:

    • ENCODE and Roadmap Epigenomics data for regulatory elements

    • ChIP-seq datasets to identify transcription factors regulating KCNV1

    • Chromosome conformation capture data to understand 3D genome organization around the KCNV1 locus

These resources provide critical context for interpreting experimental findings, allowing researchers to place their KCNV1 results within broader biological frameworks and disease associations .

How can discrepancies in experimental results between different KCNV1 studies be systematically evaluated?

When evaluating discrepancies between different KCNV1 studies:

  • Source variables to consider:

    • Species differences: Variations between human, Pongo abelii, or other primate KCNV1 orthologs

    • Experimental systems: Different expression systems (Xenopus oocytes, HEK293, neurons)

    • Methodological approaches: Electrophysiology techniques, biochemical assays, or imaging methods

    • Protein constructs: Full-length versus truncated proteins, tagged versus untagged variants

    • Experimental conditions: Temperature, ionic conditions, membrane composition

  • Systematic evaluation framework:

    • Step 1: Compare experimental methodologies in detail (not just methods summaries)

    • Step 2: Assess protein expression levels across studies (overexpression can cause artifacts)

    • Step 3: Evaluate the presence/absence of interacting partners in different systems

    • Step 4: Consider posttranslational modifications and their effects

    • Step 5: Replicate key experiments from conflicting studies under identical conditions

  • Case example: When comparing studies of KCNV1's effects on Kv2 channels, one might find discrepancies in the magnitude of inhibition. These could be systematically evaluated by:

    • Comparing expression ratios between KCNV1 and Kv2 subunits

    • Assessing membrane trafficking efficiency in different cell types

    • Analyzing the composition of recording solutions

    • Examining differences in voltage protocols used for channel activation

This systematic approach transforms apparently conflicting data into complementary insights about context-dependent KCNV1 function .

What computational models are available or needed to better predict KCNV1's effects on neuronal excitability?

Computational modeling approaches for KCNV1 function:

  • Currently available models:

    • Hodgkin-Huxley type models: Can be adapted to incorporate KCNV1 modulatory effects on Kv2 channels

    • Markov models: Better capture complex state transitions in heteromeric channel assemblies

    • Molecular dynamics simulations: Provide atomic-level insights into KCNV1-Kv2 interactions

  • Model development needs:

    • Multi-scale models: Connecting molecular interactions to cellular and network effects

    • Stochastic models: Accounting for variability in channel expression and heteromeric assembly

    • Developmental models: Capturing changes in KCNV1 function throughout neuronal maturation

    • Neural network models: Predicting the impact of KCNV1 variants on circuit dynamics

  • Data requirements for improved models:

    • Precise stoichiometry of KCNV1-Kv2 heteromeric channels

    • Single-channel properties of various heteromeric combinations

    • Cell-type specific expression patterns across brain regions

    • Quantitative data on regulation by second messengers and post-translational modifications

  • Validation approaches:

    • Compare model predictions with experimental recordings from neurons

    • Test model predictions about neuronal firing patterns under various conditions

    • Validate using genetic manipulations of KCNV1 expression levels

The development of comprehensive computational models would allow researchers to better predict how KCNV1 variants or expression changes affect neuronal excitability and potentially contribute to conditions like epilepsy or schizophrenia .

What is the potential relevance of Pongo abelii KCNV1 research to understanding human neurological disorders?

Pongo abelii KCNV1 research has several translational implications for human neurological disorders:

  • Evolutionary insights:

    • Comparing human and orangutan KCNV1 can reveal conserved domains critical for channel function

    • Identifying primate-specific adaptations may highlight regions important for advanced cognitive functions

    • Understanding evolutionary constraints can help distinguish pathogenic from benign variants

  • Disease mechanisms:

    • Human KCNV1 maps to chromosome 8q23.3, a locus for benign adult familial myoclonic epilepsy

    • KCNV1 has been implicated in schizophrenia pathophysiology through both common variation and expression studies

    • As a modulator of neuronal excitability, KCNV1 dysfunction may contribute to various neurological conditions

  • Comparative disease models:

    • Orangutans provide a phylogenetically relevant model for human neurological disorders

    • Comparing KCNV1 function across primates can reveal species-specific vulnerabilities

    • Non-human primate models may better recapitulate human disease phenotypes than rodent models

  • Therapeutic implications:

    • Understanding KCNV1's modulatory effects on Kv2 and Kv3 channels could lead to novel therapeutic targets

    • Compounds that modulate KCNV1-containing heteromeric channels might have applications in treating epilepsy or schizophrenia

    • Leveraging evolutionary information can help design more specific channel modulators

The high conservation of potassium channel function across primates suggests that findings from Pongo abelii KCNV1 studies may have direct relevance to understanding human disease mechanisms .

How might interactions between KCNV1 and other potassium channels contribute to neurological disease mechanisms?

The modulatory interactions between KCNV1 and other potassium channels may contribute to neurological disease through several mechanisms:

Understanding these complex interactions could provide insights into both disease mechanisms and potential therapeutic approaches.

What emerging technologies hold promise for advancing KCNV1 research?

Several emerging technologies show particular promise for advancing KCNV1 research:

  • CRISPR/Cas9 genome editing:

    • Generation of precise knockin models in various species

    • Introduction of human disease-associated variants in model systems

    • Creation of reporter systems for monitoring KCNV1 expression in real-time

    • Development of inducible knockout systems to study acute versus developmental effects

  • Advanced electrophysiology techniques:

    • High-throughput automated patch-clamp for screening KCNV1 variants

    • Optogenetic control of KCNV1-expressing neurons

    • In vivo electrophysiology combined with cell-type specific manipulations

    • Voltage imaging to monitor activity across neural networks

  • Single-cell multi-omics:

    • Simultaneous profiling of transcriptome, proteome, and electrophysiological properties

    • Spatial transcriptomics to map KCNV1 expression in brain tissue with cellular resolution

    • Single-cell proteomics to identify cell-type specific interacting partners

  • Advanced structural biology approaches:

    • Cryo-EM structures of KCNV1 in complex with Kv2 channels

    • Molecular dynamics simulations of heteromeric channel assemblies

    • Structure-based drug design targeting KCNV1-containing channel complexes

  • Organoid and advanced in vitro systems:

    • Brain organoids to study KCNV1 function in a human neuronal context

    • Microfluidic systems to investigate KCNV1 in defined neural circuits

    • Organ-on-chip approaches combining neurons with other cell types

These technologies will enable more precise characterization of KCNV1 function at molecular, cellular, and systems levels, potentially revealing new therapeutic opportunities for neurological disorders .

What are the most significant knowledge gaps in understanding KCNV1 function that require further investigation?

Despite progress in KCNV1 research, several critical knowledge gaps remain:

  • Structural determinants of modulatory function:

    • The specific protein domains and residues that mediate KCNV1's interaction with Kv2 and Kv3 channels

    • The stoichiometry of heteromeric channels containing KCNV1

    • The structural basis for KCNV1's inability to form functional homomeric channels

  • Cell-type specific roles:

    • The expression pattern of KCNV1 across different neuronal populations

    • Whether KCNV1 has differential effects depending on neuronal type

    • How KCNV1 expression is regulated during development and in response to activity

  • Signaling and regulation:

    • Post-translational modifications that regulate KCNV1 function

    • Signaling pathways that modulate KCNV1-containing channel complexes

    • Whether KCNV1 itself participates in signaling beyond its channel modulatory role

  • Species differences:

    • Functional differences between human and Pongo abelii KCNV1

    • Species-specific interaction partners

    • Evolutionary adaptations in regulatory elements controlling KCNV1 expression

  • Disease mechanisms:

    • The precise contribution of KCNV1 dysfunction to epilepsy and schizophrenia

    • Whether KCNV1 variants directly cause disease or act as risk modifiers

    • The potential role of KCNV1 in other neurological and psychiatric conditions

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, electrophysiology, genetics, and systems neuroscience .

What interdisciplinary collaborations would most benefit KCNV1 research progress?

Advancing KCNV1 research would benefit significantly from the following interdisciplinary collaborations:

  • Structural biologists and electrophysiologists:

    • Combining structural insights with functional characterization

    • Correlating structural features with biophysical properties

    • Using structure-guided mutagenesis to test functional hypotheses

  • Evolutionary biologists and neuroscientists:

    • Comparing KCNV1 across primate species

    • Relating evolutionary changes to functional adaptations

    • Understanding selective pressures on potassium channel evolution

  • Computational neuroscientists and cellular neurophysiologists:

    • Developing multi-scale models of KCNV1 function

    • Predicting network effects of KCNV1 modulation

    • Testing model predictions with cellular recordings

  • Clinicians and basic scientists:

    • Connecting KCNV1 variants to clinical phenotypes

    • Translating basic research findings to potential therapeutic approaches

    • Identifying biomarkers of KCNV1 dysfunction

  • Geneticists and molecular biologists:

    • Identifying regulatory networks controlling KCNV1 expression

    • Characterizing epigenetic influences on KCNV1 function

    • Developing genetic tools for manipulating KCNV1 in vivo

  • Pharmaceutical scientists and electrophysiologists:

    • Designing compounds that selectively modulate KCNV1-containing channels

    • Developing screening assays for potential therapeutics

    • Testing compounds in relevant disease models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.