Recombinant Pongo abelii Probable palmitoyltransferase ZDHHC21 (ZDHHC21)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Pongo abelii Probable palmitoyltransferase ZDHHC21 (ZDHHC21) is a synthetic protein derived from the Sumatran orangutan (Pongo abelii) and engineered for experimental use. It belongs to the zinc finger DHHC domain-containing (ZDHHC) family of palmitoyltransferases, enzymes that catalyze the post-translational modification of proteins by adding palmitoyl groups . This modification regulates protein localization, stability, and interactions in cellular processes such as signaling, metabolism, and immune response .

The recombinant protein is expressed in E. coli with an N-terminal His tag for purification, spans the full-length sequence (1–265 amino acids), and maintains >90% purity as verified by SDS-PAGE . Its molecular weight is approximately 31.4–31.5 kDa, depending on the host system and tagging .

Biological Functions

ZDHHC21 palmitoylates specific substrates to regulate diverse cellular pathways:

Mitochondrial Oxidative Phosphorylation (OXPHOS)

In acute myeloid leukemia (AML), ZDHHC21 palmitoylates adenylate kinase 2 (AK2), enhancing mitochondrial OXPHOS activity and supporting leukemia stem cell (LSC) survival . Inhibition of ZDHHC21 reduces OXPHOS, induces myeloid differentiation, and eradicates AML blasts, particularly in FLT3-ITD–mutated cases .

T-Cell Signaling

ZDHHC21 is Ca²⁺/calmodulin-dependent and mediates S-acylation of proximal T-cell receptor (TCR) signaling proteins. Mice lacking functional ZDHHC21 (Zdhhc21dep) show impaired CD4⁺ T-cell activation and differentiation into Th1/Th2/Th17 effector subsets .

Vascular Function

ZDHHC21 palmitoylates α1D adrenergic receptors, modulating vascular tone. ZDHHC21-deficient mice exhibit reduced responsiveness to α1 agonists, leading to tachycardia and hypotension .

Cancer Pathways

ZDHHC21 regulates androgen receptor (AR) and sex steroid hormone receptor palmitoylation, influencing rapid non-genomic signaling via ERK/AKT pathways . In colorectal cancer, it interacts with fatty acid synthase (FASN) to drive metabolic reprogramming .

Research Applications

ApplicationDetailsSource
AML TherapyRecombinant ZDHHC21 inhibition studies; enhances chemotherapy efficacy
Mechanistic StudiesPalmitoylation assays (e.g., AK2, TCR proteins, α1D AR)
Protein PurificationHis-tagged ZDHHC21 used to study substrate specificity (e.g., AK2)
Cancer MetabolismRole in OXPHOS and FASN axis in colorectal cancer models

Therapeutic Potential

ZDHHC21 inhibition is emerging as a strategy for:

  • AML Treatment: Targeting OXPHOS dependency in relapsed/refractory AML, particularly FLT3-ITD mutants .

  • Cancer Metabolism: Disrupting FASN axis in colorectal cancer .

  • Vascular Diseases: Modulating α1 adrenergic receptor signaling to regulate blood pressure .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
ZDHHC21; Palmitoyltransferase ZDHHC21; Zinc finger DHHC domain-containing protein 21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
ZDHHC21
Target Protein Sequence
MGLRIHFVVDPHGWCCMGLIVFVWLYNIVLIPKIVLFPHYEEGHIPGILIIIFYGISIFC LVALVRASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHC PWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIM RLAAFMGITMLVGITGLFYTQLIGIITDTTSIEKMSNCCEDISRPRKPWQQTFSEVFGTR WKILWFIPFRQRQPLRVPYHFANHV
Uniprot No.

Target Background

Function

ZDHHC21 is a palmitoyltransferase that catalyzes the palmitoylation of various protein substrates. It palmitoylates sex steroid hormone receptors (ESR1, PGR, and AR), influencing their plasma membrane localization and thereby regulating rapid intracellular signaling via ERK and AKT kinases and cAMP generation. This activity does not affect signaling mediated by the nuclear receptor function of these hormones. ZDHHC21 also palmitoylates FYN, impacting its localization within hair follicles and playing a crucial role in epidermal homeostasis and hair follicle differentiation. Through PLCB1 palmitoylation and subsequent downstream signaling regulation, ZDHHC21 may indirectly affect endothelial barrier function and leukocyte adhesion. Additionally, ZDHHC21 palmitoylates ADRA1D, positively regulating its activity and expression, potentially influencing vascular contraction. Finally, it may also palmitoylate eNOS and LCK.

Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of ZDHHC21 and how does it compare across species?

ZDHHC21 is a member of the ZDHHC family of protein acyl transferases that catalyze the addition of palmitate to specific cysteine residues on target proteins. The recombinant Pongo abelii (Sumatran orangutan) ZDHHC21 consists of 265 amino acids with a full amino acid sequence that includes characteristic DHHC motifs common to this enzyme family . The protein contains a zinc finger DHHC domain, which is crucial for its palmitoyltransferase activity with the enzymatic classification EC 2.3.1.- .

Comparative analysis reveals high conservation of the catalytic domain across species, though the Pongo abelii variant has specific sequence characteristics that make it valuable for comparative studies against human ZDHHC21. The protein's secondary structure includes transmembrane domains that facilitate its localization to cellular membranes, critical for its function in modifying membrane-associated proteins.

What cellular functions does ZDHHC21 regulate through protein palmitoylation?

ZDHHC21 catalyzes the addition of the saturated lipid palmitate to target proteins, a post-translational modification that can significantly alter protein localization, stability, and function . Research demonstrates that ZDHHC21 regulates several critical cellular processes through palmitoylation of specific substrate proteins:

  • Vascular tone regulation: ZDHHC21 modulates α1 adrenergic receptor signaling by forming a complex with and increasing palmitoylation of α1D adrenergic receptors, thereby affecting vascular responsiveness .

  • Oxidative phosphorylation: ZDHHC21 serves as a key regulator of oxidative phosphorylation (OXPHOS) hyperactivity in acute myeloid leukemia (AML) cells by catalyzing the palmitoylation of mitochondrial adenylate kinase 2 (AK2) .

  • Endothelial function: ZDHHC21 supports palmitoylation of important functional proteins in endothelial cells, including endothelial nitric oxide synthase (eNOS) and PECAM1, a cell adhesion molecule involved in angiogenesis and transendothelial cell migration .

These diverse functions highlight the importance of ZDHHC21 as a regulator of multiple physiological processes through its palmitoyltransferase activity.

What are the optimal storage and handling conditions for recombinant ZDHHC21 protein?

Recombinant ZDHHC21 requires specific storage conditions to maintain its structural integrity and enzymatic activity. The protein should be stored in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein . For long-term storage, maintain the protein at -20°C or -80°C to preserve activity .

For working protocols, it is recommended to prepare small aliquots to avoid repeated freeze-thaw cycles, which can significantly diminish enzymatic activity. Working aliquots may be stored at 4°C for up to one week . When preparing the protein for experimental use, gentle thawing at 4°C is preferred over rapid thawing at higher temperatures to prevent protein denaturation.

The following table summarizes the optimal storage conditions for recombinant ZDHHC21:

Storage PurposeTemperatureMaximum DurationBuffer Composition
Long-term storage-20°C to -80°CSeveral monthsTris-based buffer with 50% glycerol
Working aliquots4°CUp to one weekOriginal buffer
Experimental useOn iceHoursExperiment-specific buffer

How can researchers effectively measure ZDHHC21 palmitoyltransferase activity in vitro?

Measuring ZDHHC21's enzymatic activity requires specific techniques that can detect protein palmitoylation. Two principal methodologies have been validated in research settings:

  • Metabolic labeling with click chemistry: This approach utilizes alkyne-tagged palmitate analogs (such as 17-octadecynoic acid, ODYA) that are metabolically incorporated into proteins. After cell lysis, the tagged proteins undergo copper-catalyzed click chemistry reaction with azide-conjugated fluorophores or biotin for detection and quantification . While highly sensitive, this method reflects both increased steady-state palmitoylation and increased turnover.

  • Resin-assisted capture (acyl-RAC): This label-free method purifies palmitoylated proteins from a mixture in the presence of hydroxylamine, which specifically cleaves thioester bonds between palmitate and cysteine residues. The method reflects the total pool of palmitoylated protein present and distinguishes between non-palmitoylated proteins and those with at least one palmitoyl group .

For quantitative analysis, researchers should consider:

  • Including both positive controls (known ZDHHC21 substrates) and negative controls

  • Comparing wild-type ZDHHC21 with catalytically inactive mutants (such as F233Δ)

  • Analyzing dose-dependent responses to validate specificity

  • Using mass spectrometry to identify palmitoylation sites

These methodologies provide complementary information about ZDHHC21's palmitoyltransferase activity and can be selected based on experimental objectives.

How does ZDHHC21 interact with adrenergic receptor signaling pathways?

ZDHHC21 has been identified as a novel regulator of α1 adrenergic receptor (AR) signaling through direct protein-protein interaction and catalytic modification . Experimental evidence demonstrates that ZDHHC21 forms a molecular complex with α1D AR and increases its palmitoylation, which affects receptor functionality .

The mechanistic pathway involves:

  • Direct interaction: ZDHHC21 physically associates with α1D AR, enabling site-specific palmitoylation of the receptor .

  • Palmitoylation effects: Addition of palmitate to α1D AR creates a fourth cytoplasmic loop in the receptor structure, which is typical for class A GPCRs. This structural modification influences receptor trafficking, membrane localization, and signal transduction properties .

  • Physiological consequences: Mice with a nonfunctional ZDHHC21 (F233Δ mutation) display diminished responses to α1 AR agonists like phenylephrine, while maintaining normal responses to other vasoconstrictors such as serotonin . The mutant mice exhibit hypotension and tachycardia, consistent with reduced vascular tone resulting from impaired α1 AR signaling .

  • Compensatory mechanisms: In response to reduced α1 AR functionality, F233Δ mice show elevated endogenous catecholamine levels and increased vascular α1 AR gene expression .

This signaling axis represents a novel molecular mode of regulation for vascular tone and blood pressure, highlighting ZDHHC21 as a potential therapeutic target for cardiovascular conditions.

What is the role of ZDHHC21 in regulating oxidative phosphorylation in cancer cells?

ZDHHC21 has emerged as a key regulator of oxidative phosphorylation (OXPHOS) in acute myeloid leukemia (AML) cells, particularly in leukemia stem cells (LSCs) that are responsible for disease relapse . Research has uncovered a specific molecular mechanism by which ZDHHC21 supports OXPHOS hyperactivity in these cells:

  • Substrate specificity: ZDHHC21 specifically catalyzes the palmitoylation of mitochondrial adenylate kinase 2 (AK2) . This post-translational modification appears critical for AK2's role in supporting OXPHOS.

  • Metabolic consequences: AML cells, especially LSCs, are highly dependent on OXPHOS for survival. ZDHHC21-mediated palmitoylation of AK2 activates OXPHOS in leukemic blasts, contributing to their metabolic fitness and survival .

  • Differential expression: FLT3-ITD-mutated AML cells express significantly higher levels of ZDHHC21 and exhibit enhanced sensitivity to ZDHHC21 inhibition, suggesting a potential therapeutic vulnerability .

  • Therapeutic implications: Depletion or inhibition of ZDHHC21 effectively induces myeloid differentiation and weakens stemness potential by inhibiting OXPHOS in AML cells . This approach represents a noncytotoxic strategy to target the metabolic dependencies of therapy-resistant LSCs.

Experimental data from both cell line models and patient-derived xenografts demonstrate that targeting ZDHHC21 arrests the in vivo growth of AML cells and extends survival in mouse models. Moreover, ZDHHC21 inhibition enhances chemotherapy efficacy in relapsed/refractory leukemia , highlighting its potential as a therapeutic target.

How can researchers design experiments to identify novel substrates of ZDHHC21?

Identifying novel substrates of ZDHHC21 requires a systematic approach combining multiple complementary techniques:

  • Proteomics-based approaches:

    • Stable Isotope Labeling with Amino acids in Cell culture (SILAC) combined with 17-ODYA labeling allows quantitative comparison of palmitoylated proteins between ZDHHC21-expressing and ZDHHC21-depleted cells

    • Acyl-biotin exchange (ABE) or acyl-RAC combined with mass spectrometry can identify proteins with differential palmitoylation depending on ZDHHC21 expression

  • Candidate-based approaches:

    • Computational prediction of palmitoylation sites in proteins that function in ZDHHC21-regulated pathways

    • Co-immunoprecipitation studies to identify physical interactions between ZDHHC21 and potential substrates

    • Site-directed mutagenesis of predicted palmitoylated cysteines to validate functional importance

  • Validation strategies:

    • Reconstitution experiments with purified ZDHHC21 and candidate substrates in vitro

    • Comparison of wild-type ZDHHC21 with catalytically inactive mutants (F233Δ) in cellular models

    • Functional assays to determine the physiological relevance of substrate palmitoylation

When designing these experiments, researchers should consider the localization of ZDHHC21 (primarily in the endoplasmic reticulum and Golgi apparatus) and the tissue-specific expression patterns of both ZDHHC21 and potential substrates to enhance the probability of identifying physiologically relevant interactions.

What approaches can be used to develop specific inhibitors of ZDHHC21 for therapeutic applications?

Developing specific inhibitors of ZDHHC21 presents a promising therapeutic strategy, particularly for diseases where ZDHHC21 hyperactivity contributes to pathology, such as acute myeloid leukemia or certain cardiovascular conditions . Several complementary approaches can be employed:

  • Structure-based drug design:

    • Determine the three-dimensional structure of ZDHHC21's catalytic domain using X-ray crystallography or cryo-electron microscopy

    • Conduct in silico screening of compound libraries targeting the active site or allosteric sites

    • Design competitive inhibitors that mimic the structure of palmitoyl-CoA, the natural substrate

  • High-throughput screening:

    • Develop cell-based assays monitoring palmitoylation of known ZDHHC21 substrates such as α1D AR or AK2

    • Screen chemical libraries for compounds that inhibit ZDHHC21-mediated palmitoylation

    • Validate hits using secondary assays to confirm target engagement and specificity

  • Selectivity considerations:

    • Compare inhibition profiles across multiple ZDHHC family members to identify compounds with preferential activity against ZDHHC21

    • Test compounds against a panel of enzymes that utilize acyl-CoA substrates to exclude non-specific effects

    • Evaluate the binding kinetics and reversibility of inhibition

  • Therapeutic validation:

    • Test lead compounds in disease-relevant models, such as AML cell lines with FLT3-ITD mutations

    • Evaluate efficacy in combination with standard-of-care treatments

    • Assess toxicity profiles in relation to on-target inhibition versus off-target effects

When developing ZDHHC21 inhibitors, researchers should consider that complete inhibition might have unintended consequences on physiological processes like vascular tone regulation , necessitating careful dosing strategies and potentially tissue-specific delivery approaches.

How does the F233Δ mutation affect ZDHHC21 function and what can we learn from this model?

The F233Δ mutation, which results in deletion of phenylalanine at position 233 in ZDHHC21, has proven invaluable for understanding the enzyme's function. This naturally occurring mutation in the depilated mouse model (MGI: 94884) provides several insights:

  • Catalytic activity: The F233Δ mutation renders ZDHHC21 catalytically inactive toward established substrates, including eNOS and Fyn, in in vitro assays . This loss of acyl transferase activity serves as an excellent negative control in palmitoylation studies.

  • Physiological effects: Homozygous F233Δ mice display:

    • Reduced responsiveness to α1 adrenergic receptor agonists

    • Hypotension and tachycardia consistent with diminished vascular tone

    • Elevated endogenous catecholamine levels and increased vascular α1 AR gene expression

    • Normal responses to other vasoactive stimuli, such as serotonin and high potassium

  • Molecular mechanisms: The mutation reveals substrate specificity of ZDHHC21, as it affects palmitoylation of:

    • α1D adrenergic receptors, impairing their function

    • Other potential targets including eNOS, PECAM1, Fyn, and sex steroid receptors

The F233Δ model provides a unique tool to study the consequences of ZDHHC21 deficiency in an intact organism, allowing researchers to:

  • Distinguish between direct and compensatory effects

  • Identify physiologically relevant substrates

  • Understand tissue-specific roles of ZDHHC21

  • Explore potential therapeutic applications of ZDHHC21 inhibition

This model demonstrates the critical importance of a single amino acid in maintaining the catalytic function of ZDHHC21 and provides a framework for structure-function studies of other ZDHHC family members.

What methods are recommended to study the tissue-specific effects of ZDHHC21 deficiency?

Investigating tissue-specific effects of ZDHHC21 deficiency requires a multifaceted approach combining genetic, molecular, and physiological techniques:

  • Tissue-specific conditional knockout models:

    • Generate floxed ZDHHC21 alleles for Cre-loxP-mediated tissue-specific deletion

    • Employ tissue-specific promoters to drive Cre recombinase expression (e.g., Tie2-Cre for endothelial cells, SM22α-Cre for smooth muscle cells)

    • Use tamoxifen-inducible systems (CreERT2) to control the timing of ZDHHC21 deletion

  • Molecular profiling:

    • Conduct comparative transcriptomics (RNA-seq) of tissues from wild-type and ZDHHC21-deficient models

    • Perform proteomics analysis with a focus on the palmitoylated proteome using acyl-RAC or ABE methods

    • Investigate tissue-specific protein-protein interaction networks through proximity labeling approaches

  • Functional assessments:

    • For vascular tissues: Measure vascular reactivity in isolated vessel preparations, monitor blood pressure in vivo, and assess endothelial function

    • For hematopoietic tissues: Analyze differentiation potential, metabolic profiles focusing on OXPHOS activity, and leukemia stem cell functionality

    • For other tissues: Design appropriate functional tests based on ZDHHC21 expression patterns

  • Rescue experiments:

    • Reintroduce wild-type or mutant ZDHHC21 in deficient tissues to establish causality

    • Express ZDHHC21 with mutations in specific domains to dissect structural requirements

    • Test pharmacological interventions that might bypass ZDHHC21 deficiency

This comprehensive approach enables researchers to determine how ZDHHC21 deficiency affects different tissues and cell types, providing insights into both the fundamental biology of protein palmitoylation and potential therapeutic applications for tissue-specific targeting of ZDHHC21.

How might ZDHHC21 inhibition be leveraged for treating acute myeloid leukemia?

ZDHHC21 inhibition represents a promising therapeutic strategy for acute myeloid leukemia (AML), particularly for relapsed or refractory cases. Research has identified several mechanisms that support this approach:

  • Metabolic targeting: AML cells, especially leukemia stem cells (LSCs), are highly dependent on mitochondrial oxidative phosphorylation (OXPHOS) for survival. ZDHHC21 serves as a key regulator of OXPHOS hyperactivity in these cells by catalyzing the palmitoylation of mitochondrial adenylate kinase 2 (AK2) .

  • Differentiation induction: Depletion or inhibition of ZDHHC21 effectively induces myeloid differentiation and weakens stemness potential in AML cells by inhibiting OXPHOS . This represents a noncytotoxic strategy to target therapy-resistant LSCs.

  • Targeted vulnerability: FLT3-ITD-mutated AML cells express significantly higher levels of ZDHHC21 and exhibit enhanced sensitivity to ZDHHC21 inhibition, suggesting a potential biomarker-driven approach to patient selection .

  • Therapeutic synergy: Targeting ZDHHC21 markedly eradicates AML blasts and enhances chemotherapy efficacy in relapsed/refractory leukemia models . This indicates potential for combination therapy approaches.

Experimental evidence from both cell line models and patient-derived xenografts demonstrates that inhibition of ZDHHC21 arrests the in vivo growth of AML cells and extends survival in mouse models . These findings suggest that ZDHHC21 inhibition could be developed as a novel therapeutic regimen for AML patients, with particular promise for those with relapsed or refractory disease and those harboring FLT3-ITD mutations.

What considerations should guide the development of ZDHHC21-targeting therapeutics for cardiovascular applications?

Developing ZDHHC21-targeting therapeutics for cardiovascular applications requires careful consideration of its role in vascular function and potential off-target effects:

  • Mechanistic understanding: ZDHHC21 regulates α1 adrenergic receptor signaling by forming a complex with and increasing palmitoylation of α1D AR . This affects vascular responsiveness to α1 AR agonists and consequently influences vascular tone and blood pressure.

  • Potential applications:

    • Hypertension: Inhibiting ZDHHC21 might reduce vascular tone by decreasing α1 AR signaling, potentially lowering blood pressure

    • Vascular hyperreactivity disorders: Conditions characterized by excessive vasoconstriction might benefit from ZDHHC21 inhibition

    • Cardiac hypertrophy: Since α1 AR signaling contributes to pathological cardiac remodeling, ZDHHC21 inhibition might offer cardioprotection

  • Safety considerations:

    • Cardiovascular effects: Complete ZDHHC21 inhibition might lead to excessive hypotension or reflex tachycardia, as observed in F233Δ mice

    • Substrate promiscuity: ZDHHC21 palmitoylates multiple proteins including eNOS and PECAM1 , potentially affecting additional vascular functions

    • Tissue expression: ZDHHC21 is expressed in various tissues, suggesting possible systemic effects of inhibition

  • Strategic approaches:

    • Partial inhibition: Developing partial rather than complete inhibitors of ZDHHC21 to avoid excessive cardiovascular effects

    • Tissue-targeted delivery: Designing vascular-specific delivery systems to minimize off-target effects

    • Combination therapy: Using ZDHHC21 inhibitors at lower doses in combination with other antihypertensive agents

The development pathway should include careful assessment of dose-response relationships, cardiovascular safety monitoring, and evaluation of effects on multiple ZDHHC21 substrates. Animal models with tissue-specific ZDHHC21 deletion would be valuable for predicting the outcomes of pharmacological inhibition in specific cardiovascular tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.