Recombinant Pongo abelii Proline-rich transmembrane protein 2 (PRRT2)

Shipped with Ice Packs
In Stock

Description

Topology

PRRT2 adopts a type II transmembrane topology :

  • N-terminal: Cytosolic, proline-rich domain (residues 1–274) critical for binding synaptic proteins like Intersectin 1 .

  • C-terminal: Single transmembrane helix (residues 324–344) with an extracellular orientation, essential for regulating Nav1.2 channel surface expression .

Molecular dynamics simulations reveal that the first transmembrane domain (residues 275–295) forms a stable helix-loop-helix motif within the lipid bilayer .

Pathogenic Variants

Missense mutations in PRRT2 (e.g., p.P279L, p.G305W) disrupt membrane localization or reduce protein stability, leading to paroxysmal disorders like epilepsy and kinesigenic dyskinesia . Truncating mutations (e.g., c.649dupC) account for ~78.5% of pathogenic cases and result in haploinsufficiency .

Research Applications

Recombinant PRRT2 is utilized in:

  • Electrophysiology: Modulating Nav1.2/Nav1.6 sodium channel gating and inactivation .

  • Protein Interaction Studies: Binding SNARE complex components (e.g., SNAP-25) .

  • Disease Modeling: Investigating PRRT2-linked paroxysmal disorders in vitro .

Key Research Findings

StudyKey ResultCitation
PRRT2-Nav1.2 InteractionNH2-terminal binds Nav1.2; COOH-terminal reduces current density by 40% .
Pathogenicity Classification15/29 missense variants classified as "likely pathogenic" (e.g., p.G323R) .
Structural DynamicsHelix-loop-helix motif in TM1 stabilizes membrane association .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PRRT2; Proline-rich transmembrane protein 2; Dispanin subfamily B member 3; DSPB3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
PRRT2
Target Protein Sequence
MAASSSEISEMKGVEESPEVPGEGPGHSEAETGPPQVLAGVPDQPEALQPGPDTTAALVD SGPKAELAPETTETPAGASETAQATDLSLSPGGESKANCSPEDLCQETVSKPEVSKETTA DQGSRLESAAPPEPAPEPAPQPDPQPDSQPTPKPALQPELPTQEDPTPEILSESVGEKQE NGAVVPLQAGDGEEGPAPEPHSPPSKKSPPANGAPPRVLQQLVEEDRMGRAHSGHPGSPR GSLSRHPSSQLAGPGVEGGEGTQKPRDYIILAILSCFCPMWPVNIVAFAYAVMSRNSLQQ GDVDGAQRLGRVAKLLSIVALVGGVLIIIASCVINLGVYK
Uniprot No.

Target Background

Function

As a component of the AMPAR complex's outer core, this protein may be involved in central nervous system synaptic transmission. In hippocampal neuron presynaptic terminals, it plays a crucial role in the final stages of neurotransmitter release, potentially by regulating calcium sensing. In the cerebellum, it may inhibit SNARE complex formation and downregulate short-term facilitation.

Database Links
Protein Families
CD225/Dispanin family
Subcellular Location
Cell membrane; Single-pass membrane protein. Cell junction, synapse, presynaptic cell membrane; Single-pass membrane protein. Cell junction, synapse. Cell projection, axon. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane. Cell junction, synapse, postsynaptic density membrane. Cell projection, dendritic spine.

Q&A

What are the primary functional roles of PRRT2 in the nervous system?

PRRT2 serves multiple crucial functions in the nervous system:

  • Synaptic transmission regulation: PRRT2 interacts with components of the SNARE complex and modulates its formation, playing a key role in neurotransmitter release .

  • Ion channel regulation: PRRT2 negatively regulates voltage-gated Nav1.2 and Nav1.6 channels by modulating their voltage-dependent state of inactivation and recovery from inactivation .

  • Neurodevelopmental role: PRRT2 is highly expressed during early developmental stages and plays a role in synaptogenesis, neuronal migration, and synaptic development. Its expression declines during adulthood, suggesting critical age windows for PRRT2-related phenotypes .

  • Cellular excitability regulation: Loss of PRRT2 function results in increased sodium currents and augmented spontaneous firing in neurons, particularly when challenged with high-frequency stimulation .

How is recombinant PRRT2 protein typically produced for research purposes?

Recombinant PRRT2 protein for research can be produced through several expression systems:

  • E. coli expression system: Used for producing full-length Pongo abelii PRRT2 protein with an N-terminal His tag, as seen in catalog item RFL31567PF .

  • HEK293 expression system: Used for human PRRT2 protein production, especially when post-translational modifications are important for downstream applications .

The expressed protein can be purified using affinity chromatography (for tagged versions) and supplied in various forms:

  • Lyophilized powder

  • Solution with magnetic beads coupling

  • In buffers containing stabilizers like trehalose or glycerol

For optimal stability, recombinant PRRT2 is typically stored at -20°C/-80°C, with working aliquots kept at 4°C for up to one week to avoid repeated freeze-thaw cycles .

What are the optimal conditions for studying PRRT2 protein-protein interactions in vitro?

To study PRRT2 protein-protein interactions effectively:

  • Expression and purification: Express recombinant PRRT2 with appropriate tags (His, GST, etc.) and purify under native conditions to preserve protein folding. Maintain a storage buffer of Tris/PBS-based buffer with 6% trehalose or 50% glycerol at pH 8.0 .

  • Protein partners selection: Based on known interactions, prioritize SNAP25, PNKD, SCN2A, SYT1, and SCN1A as primary binding partners for validation studies .

  • Interaction assays:

    • Co-immunoprecipitation: Use pre-coupled magnetic beads with recombinant PRRT2 for pull-down assays. These beads have uniform particle size and narrow size distribution with large surface area, facilitating convenient and fast capture of target molecules with high specificity .

    • Proximity-based assays: FRET or BRET to detect real-time interactions.

    • Surface Plasmon Resonance: For quantitative binding kinetics.

  • Validation strategies: Verify interactions through multiple methods including reverse co-IP, subcellular co-localization studies, and functional validation in neuronal models.

The optimal buffer conditions typically include physiological pH (7.2-7.4), 150mM NaCl, and low concentrations of non-ionic detergents (0.1% Triton X-100) when working with the transmembrane region.

How can PRRT2 function be effectively assessed in cellular models?

To assess PRRT2 function in cellular models:

  • Expression system selection:

    • Primary neuronal cultures: Best for physiological relevance, especially for studying synaptic functions.

    • Heterologous cell lines: HeLa or HEK293 cells for subcellular localization studies.

    • iPSC-derived neurons: Particularly from patients with PRRT2 mutations.

  • Functional assays:

    • Subcellular localization: Transfect cells with EGFP-tagged PRRT2 and observe under live cell confocal microscopy. Wild-type PRRT2 predominantly localizes to the plasma membrane, while many mutants show altered cytoplasmic localization .

    • Electrophysiology: Patch-clamp recordings to measure changes in sodium currents and neuronal firing patterns in response to PRRT2 manipulation .

    • Calcium imaging: To assess effects on calcium-dependent neurotransmitter release.

    • Synaptic vesicle release assays: FM dye loading/unloading or synaptopHluorin assays.

  • Manipulation approaches:

    • Overexpression: Wild-type vs. mutant PRRT2.

    • Knockdown/knockout: Using siRNA, shRNA, or CRISPR-Cas9.

    • Rescue experiments: Re-introduction of wild-type PRRT2 in knockout cells .

  • Analysis methods:

    • Quantify protein levels by Western blot.

    • Measure membrane vs. cytoplasmic distribution ratios.

    • Assess co-localization with synaptic markers.

    • Evaluate neuronal excitability and synaptic transmission parameters.

What methods can be used to investigate the effects of PRRT2 mutations on protein function?

To investigate effects of PRRT2 mutations:

  • Mutation introduction methods:

    • Site-directed mutagenesis for introducing specific variants.

    • Gene editing (CRISPR-Cas9) for creating cellular or animal models.

  • Protein expression and stability assessment:

    • Western blot analysis to compare expression levels of wild-type vs. mutant PRRT2.

    • Pulse-chase experiments to determine protein half-life.

    • As demonstrated in studies, 12 variants (p.P279L, p.W281R, p.A287T, p.R295Q, p.G305W, p.A306T, p.R308C, p.S317N, p.G323R, p.G323E, p.G324R, and p.G324E) showed dramatically reduced expression or hardly detectable protein levels compared to wild-type PRRT2 .

  • Subcellular localization assessment:

    • Live cell confocal microscopy of fluorescently-tagged wild-type and mutant PRRT2.

    • Research has shown that 13 mutant forms of PRRT2 (p.S275F, p.P279L, p.W281R, p.A287T, p.A291V, p.G305W, p.A306T, p.A306D, p.S317N, p.G323R, p.G323E, p.G324R, and p.G324E) lost membrane targeting and were mislocalized to the cytoplasm .

  • Functional consequences:

    • Electrophysiological recordings to assess effects on neuronal excitability.

    • Calcium imaging to evaluate impact on calcium signaling.

    • Assessment of interactions with known binding partners like SNAP25 and voltage-gated sodium channels.

  • Pathogenicity classification:

    • Apply ACMG guidelines using in silico prediction tools (SIFT, PolyPhen-2, MutationTaster).

    • Integrate population frequency data from databases like ExAC.

    • Classify variants as "pathogenic," "likely pathogenic," "uncertain significance," "likely benign," or "benign" .

How does PRRT2 modulate neuronal excitability at the molecular level?

PRRT2 modulates neuronal excitability through multiple mechanisms:

  • Direct regulation of voltage-gated sodium channels:

    • PRRT2 negatively regulates Nav1.2 and Nav1.6 channels by:

      • Modulating their voltage-dependent state of inactivation

      • Affecting their recovery from inactivation

    • In PRRT2 knockout or mutant conditions, increased Na+ currents result in markedly augmented spontaneous firing .

  • Modulation of synaptic transmission:

    • PRRT2 interacts with the SNARE complex components, particularly SNAP25.

    • It also interacts with synaptic vesicle proteins such as VAMP2 and synaptotagmins Syt1 and Syt2.

    • These interactions implicate PRRT2 in the Ca2+-sensing machinery involved in neurotransmitter release .

  • Differential effects on excitatory vs. inhibitory transmission:

    • In excitatory (glutamatergic) synapses: PRRT2 deficiency leads to increased facilitation.

    • In inhibitory (GABAergic) synapses: PRRT2 deficiency causes increased depression.

    • This creates an excitation/inhibition imbalance in the short-term potentiation frequency domain, resulting in network hyperexcitability .

  • Activity-dependent regulation:

    • PRRT2's effects are particularly pronounced during high-frequency stimulation, explaining the paroxysmal nature of PRRT2-associated disorders.

    • The network instability manifests when the system is challenged by triggers (e.g., kinesigenic stimuli in PKD) .

These mechanisms collectively explain why PRRT2-associated disorders respond well to sodium channel modulators like carbamazepine, which can normalize the abnormal neuronal firing patterns caused by PRRT2 deficiency .

What are the critical differences between PRRT2 expression and function in development versus adulthood?

PRRT2 shows distinct temporal expression patterns and functions across development:

Developmental Expression Patterns:

  • Prenatal and early postnatal periods:

    • Rapid increase in PRRT2 expression in the striatum, neocortex, hippocampus, and thalamus until approximately 100 days post-conception in humans .

    • High expression during early postnatal stages in mice when intense synaptogenesis occurs .

  • Adulthood:

    • Plateauing or declining expression levels in most brain regions .

    • Particularly notable decline in thalamic regions .

Functional Roles Across Development:

  • Developmental functions:

    • Neuronal migration: In utero PRRT2 knockout in cortical neurons causes migration delays .

    • Synaptogenesis: PRRT2 silencing negatively affects synaptic connections and development .

    • Dendritic spine formation: PRRT2 affects synaptic actin dynamics through interaction with cofilin, influencing spine density and maturation .

  • Adult functions:

    • Regulation of synaptic transmission and neuronal excitability .

    • Modulation of voltage-gated sodium channels .

Age-Dependent Clinical Manifestations:

This developmental regulation explains the age-dependent manifestations of PRRT2-related disorders:

  • Infantile period: Predominance of epileptic phenotypes (benign familial infantile epilepsy) .

  • Childhood/adolescence: Emergence of movement disorders (paroxysmal kinesigenic dyskinesia) .

  • Adulthood: Persistence of movement disorders and potential headache phenotypes .

This temporal shift in clinical manifestations likely reflects the changing expression patterns of PRRT2 across different brain regions during development and its interaction with age-dependent regulatory networks .

How do PRRT2 mutations contribute to the pathophysiology of different paroxysmal disorders?

PRRT2 mutations contribute to paroxysmal disorders through multiple mechanisms:

  • Haploinsufficiency and loss of function:

    • Most pathogenic mutations (frameshift, nonsense, splice site) lead to protein truncation or complete absence.

    • This results in approximately 50% reduction of functional PRRT2 in heterozygous carriers, explaining the autosomal dominant inheritance pattern .

  • Disrupted subcellular localization:

    • Many missense mutations, particularly in the C-terminal region, cause defective plasma membrane targeting.

    • Studies show 13 mutant variants (p.S275F, p.P279L, p.W281R, p.A287T, p.A291V, p.G305W, p.A306T, p.A306D, p.S317N, p.G323R, p.G323E, p.G324R, and p.G324E) lose membrane localization and accumulate in the cytoplasm .

  • Tissue-specific effects:

    • Different brain regions show varying vulnerability to PRRT2 dysfunction:

      • Cortical hyperexcitability: Contributes to seizure phenotypes.

      • Basal ganglia dysfunction: Underlies movement disorder phenotypes.

      • Cerebellar circuit disruption: Studies in mice with PRRT2 deletion in cerebellar granule cells show that optogenetic stimulation causes transient elevation followed by suppression of Purkinje cell firing, recapitulating PKD-like behaviors .

  • Age-dependent manifestations:

    • The specific phenotypes correlate with developmental expression patterns of PRRT2 and associated neural circuits.

    • This explains why patients may experience different manifestations at different ages:

      • Seizures predominantly in infancy

      • Movement disorders beginning later in childhood

      • In some cases, hemiplegic migraine in adolescence/adulthood .

  • Genotype-phenotype correlations:

    • Heterozygous mutations typically cause PKD, BFIC, or ICCA.

    • Biallelic (homozygous/compound heterozygous) mutations cause more severe phenotypes including developmental delay and intellectual disability .

    • Patients with truncated variants tend to have bilateral attacks and earlier onset compared to those with missense variants .

These mechanisms reveal how PRRT2 dysfunction creates paroxysmal neurological disorders through a combination of altered synaptic transmission and neuronal excitability in specific neural circuits at different developmental stages.

How can PRRT2 functional studies inform therapeutic approaches for associated disorders?

PRRT2 functional studies provide several insights for therapeutic development:

  • Mechanism-based drug targeting:

    • Sodium channel modulation: Since PRRT2 deficiency leads to increased sodium currents and neuronal hyperexcitability, sodium channel blockers like carbamazepine (CBZ) and oxcarbazepine (OXC) effectively treat these disorders .

    • Carbamazepine effectiveness: Clinical studies show complete response in most PKD patients, correlating with the ability of CBZ to normalize the abnormal firing patterns in PRRT2-deficient neurons .

  • Target identification for novel therapies:

    • SNARE complex modulation: Given PRRT2's role in regulating SNARE complex formation, compounds that stabilize this complex might compensate for PRRT2 deficiency .

    • Synaptic calcium sensing pathways: PRRT2 interacts with calcium-sensing proteins involved in neurotransmitter release, suggesting calcium signaling modulators as potential therapeutic targets .

  • Precision medicine approaches:

    • PRRT2 variant-specific responses: Different classes of mutations (truncating vs. missense) show slightly different clinical phenotypes, suggesting that therapy might be optimized based on specific genotypes .

    • Treatment response prediction: Research shows that patients with PRRT2 variants exhibit specific clinical characteristics that can help predict treatment efficacy .

  • Gene therapy potential:

    • Haploinsufficiency correction: Since most PRRT2-related disorders result from haploinsufficiency, gene replacement strategies could be effective.

    • Rescue experiments: Studies demonstrate that reintroduction of wild-type PRRT2 can fully revert abnormal neuronal firing in PRRT2-deficient models, supporting the feasibility of gene therapy approaches .

What are the challenges in developing experimental models for PRRT2-associated disorders?

Developing experimental models for PRRT2-associated disorders faces several challenges:

  • Recapitulating paroxysmal phenotypes:

    • Trigger dependence: PKD episodes are triggered by sudden movements, making it difficult to reliably induce and measure attacks in animal models.

    • Episodic nature: The paroxysmal nature of symptoms requires specialized methods to capture and quantify intermittent events.

    • Researchers have overcome this by using various triggers in mouse models, including generalized seizures, hyperthermia, or optogenetic stimulation of the cerebellum .

  • Species differences in PRRT2 expression and function:

    • Expression pattern variations: Differences in developmental timing and regional expression between human and model organism brains.

    • Functional conservation: While the protein sequence is relatively conserved (as seen in Pongo abelii PRRT2), subtle differences in interaction partners or regulatory mechanisms may exist .

  • Age-dependent phenotypes:

    • Developmental window capture: Models must capture the age-dependent manifestations (infantile seizures transitioning to later-onset dyskinesia).

    • Extended observation periods: Requires long-term monitoring of models across different developmental stages .

  • Circuit complexity:

    • Identifying relevant circuits: Multiple brain regions are implicated in different PRRT2-associated phenotypes.

    • Circuit-specific manipulation: Recent advances using cell-type specific deletion (e.g., cerebellar granule cells) have helped identify key circuits involved in PRRT2-related behaviors .

  • Technical considerations for functional assessment:

    • Protein expression challenges: PRRT2's transmembrane domain makes it difficult to express and purify in functional form.

    • Synaptic localization: Studying presynaptic proteins requires specialized techniques to access the presynaptic compartment.

    • Validation requirements: Combining multiple approaches (electrophysiology, imaging, behavioral analysis) is necessary for comprehensive phenotyping .

How can genomic and proteomic approaches be integrated to better understand PRRT2 pathophysiology?

Integrating genomic and proteomic approaches for PRRT2 research:

  • Multi-omics data integration strategies:

    • Correlating genotype with protein expression: Systematically assess how different PRRT2 variants affect protein levels, stability, and localization .

    • Transcriptome-proteome correlation: Analyze how PRRT2 mutations affect both transcriptional networks and protein interaction landscapes in relevant neural circuits.

    • Temporal profiling: Integrate developmental expression data (transcriptomics) with functional protein networks (proteomics) to understand age-dependent manifestations .

  • Advanced genetic screening methods:

    • Comprehensive variant detection: Combine gene panel testing with CNV analysis to detect various mutation types as exemplified by studies identifying heterozygous whole-gene deletions of PRRT2 .

    • Variant classification refinement: Integrate functional proteomic data with in silico predictions to improve accuracy of variant pathogenicity classification .

    • Multi-gene analysis: Examine modifier genes that might explain incomplete penetrance (estimated at 75-90% for epilepsy and 50-61% for PKD) .

  • Cutting-edge proteomic approaches:

    • Proximity labeling techniques: BioID or APEX2 to identify the complete interactome of PRRT2 at the synapse.

    • Phosphoproteomics: Characterize how PRRT2 deficiency affects synaptic phosphorylation networks that regulate neurotransmitter release.

    • Single-cell proteomics: Analyze cell-type specific effects of PRRT2 mutations in heterogeneous neural populations.

  • Functional validation pipelines:

    • High-throughput functional screening: Develop scalable assays to functionally characterize all reported PRRT2 variants.

    • CRISPR-based models: Generate isogenic cell lines with various PRRT2 mutations to eliminate confounding genetic factors.

    • Patient-derived models: Use iPSC-derived neurons from patients with different PRRT2 variants for personalized functional studies .

  • Clinical data integration:

    • Phenotype-guided analyses: Stratify molecular findings based on specific clinical presentations (PKD, infantile seizures, hemiplegic migraine).

    • Treatment response correlation: Analyze molecular signatures that predict response to sodium channel blockers or other therapies .

    • Longitudinal studies: Track changes in protein networks across developmental transitions that correlate with changing clinical manifestations .

What are the optimal methods for detecting and quantifying PRRT2 expression in different experimental systems?

For optimal PRRT2 detection and quantification:

  • mRNA detection methods:

    • RT-qPCR: Design primers specific to PRRT2 coding regions, using reference genes like POLR2A for normalization as demonstrated in research protocols .

    • In situ hybridization: For spatial expression patterns in tissue sections.

    • RNA-Seq: For comprehensive transcriptome analysis and alternative splicing detection.

  • Protein detection strategies:

    • Western blot optimization: Use fresh samples with protease inhibitors; optimal extraction with mild detergents (0.5% Triton X-100) for membrane proteins; heat samples at 37°C instead of boiling to prevent aggregation of transmembrane domains.

    • Immunofluorescence: Fixation with 4% PFA, permeabilization with 0.1% Triton X-100, and use of validated antibodies.

    • Flow cytometry: For quantitative single-cell analysis in heterogeneous populations.

  • Experimental system considerations:

    • Cell lines: HEK293, Neuro2A, or SH-SY5Y cells transfected with PRRT2 constructs.

    • Primary neurons: Typically express endogenous PRRT2, optimal for physiological studies.

    • Brain tissue: Region-specific analysis important due to differential expression patterns .

  • CNV detection for genomic analysis:

    • qPCR-based methods: Using primers targeting different regions of PRRT2 (fore, middle, and whole gene) to detect deletions .

    • Multiplex Ligation-dependent Probe Amplification (MLPA): For detecting exon-level copy number changes.

    • Computational CNV detection: From whole-exome sequencing data as validated in clinical studies .

  • Protein quantification standards:

    • Use of recombinant PRRT2 standards with known concentrations for absolute quantification.

    • Include wild-type PRRT2 as reference control when studying variants.

    • Apply subcellular fractionation to distinguish membrane-bound from cytosolic PRRT2 pools .

What are the considerations for designing PRRT2 constructs for expression studies?

When designing PRRT2 constructs for expression studies:

  • Tag selection and positioning:

    • N-terminal tags: Preferred over C-terminal tags since the C-terminus contains the transmembrane domain critical for membrane localization .

    • Tag types: EGFP tags for live imaging; smaller epitope tags (HA, FLAG, His) for biochemical studies; HaloTag or SNAP-tag for pulse-chase experiments .

    • Linker design: Include flexible linkers (GGGGS)n between tag and PRRT2 to minimize interference with protein folding.

  • Expression vector considerations:

    • Promoter selection: CMV promoter for high expression; synapsin promoter for neuron-specific expression.

    • Codon optimization: May improve expression in heterologous systems, but maintain native sequence for functional studies.

    • Inducible systems: Consider tetracycline-inducible systems to control expression levels and timing.

  • Expression system selection:

    • Prokaryotic systems: E. coli works for producing full-length protein but lacks post-translational modifications .

    • Eukaryotic systems: HEK293 cells for proper post-translational modifications; neuronal cell lines for functional studies .

    • Primary neurons: Best for physiological studies but have lower transfection efficiency.

  • Mutation introduction strategies:

    • Site-directed mutagenesis: For introducing specific variants of interest.

    • Deletion constructs: To study domain-specific functions.

    • Domain swapping: To identify critical functional regions.

  • Experimental controls:

    • Wild-type construct: Essential reference for comparing mutant phenotypes.

    • Known pathogenic variants: Include established pathogenic variants (e.g., p.P279L) as positive controls .

    • Empty vector: Important negative control for transfection experiments.

  • Storage and handling:

    • Plasmid preparation: Use endotoxin-free preparations for neuronal transfections.

    • Aliquoting: Store at -20°C and avoid freeze-thaw cycles.

    • Quality control: Verify sequence integrity and expression before experiments .

What are the key methodological approaches for investigating PRRT2 interactions with synaptic proteins and ion channels?

For investigating PRRT2 interactions with synaptic partners:

  • Protein-protein interaction methods:

    • Co-immunoprecipitation (Co-IP): Use pre-coupled magnetic beads with recombinant PRRT2 for efficient pull-down of interaction partners like SNAP25, VAMP2, or synaptotagmins .

    • Proximity labeling: BioID or APEX2 fusion to PRRT2 for in vivo identification of the proximal interactome.

    • FRET/BRET: For detecting direct interactions and conformational changes in living cells.

    • Yeast two-hybrid screening: For discovering novel interaction partners.

  • Electrophysiological approaches:

    • Patch-clamp recordings: To assess PRRT2's effects on sodium channel properties and neuronal excitability.

    • Multi-electrode arrays: For population-level activity measurements.

    • Field potential recordings: Particularly in cerebellar slices to study the effects of optogenetic stimulation of granule cells on Purkinje cell firing .

  • Advanced imaging techniques:

    • Super-resolution microscopy: STORM or PALM imaging to visualize nanoscale co-localization at synapses.

    • Live imaging: To track dynamic PRRT2 interactions during synaptic activity.

    • Calcium imaging: To assess effects on presynaptic calcium dynamics and neurotransmitter release.

  • Biochemical interaction assays:

    • Surface plasmon resonance (SPR): For quantitative binding kinetics.

    • Isothermal titration calorimetry (ITC): For thermodynamic parameters of interactions.

    • Pull-down assays with recombinant proteins: To validate direct interactions.

  • Functional validation approaches:

    • siRNA knockdown/CRISPR knockout: To examine effects of PRRT2 deficiency.

    • Overexpression of wild-type vs. mutant PRRT2: To identify dominant-negative effects.

    • Pharmacological manipulation: Using sodium channel modulators like carbamazepine to test rescue effects .

  • In silico analysis:

    • Protein structure prediction: For identifying potential interaction interfaces.

    • Molecular dynamics simulations: To model how mutations might disrupt protein-protein interactions.

    • Interactome analysis: Using databases like STRING to predict functional protein association networks, as shown for PRRT2 with predicted partners including SNAP25, PNKD, SCN2A, SYT1, and SCN1A .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.