Recombinant Pongo abelii Protein CNPPD1 (CNPPD1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNPPD1; Protein CNPPD1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-410
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
CNPPD1
Target Protein Sequence
MDLTGLLLDEEGTFSLAGFQDFTFLPGHQKLSARIRRRLYYGWDWEADCSLEELSSPVAD IAVELLQKAAPSPIRRLQKKYVAHVSREACISPCAMMLALVYIERLRHRNPDYLQHVSSS DLFLISMMVASKYLYDEGEEEEVFNDEWGAAGGVAVPTLNALERGFLSAMDWHLYTDPRE IFEVLSWLESCVAEQQGRRRGWYTYTDLCVLLEQPTWQLALGSLCQRLVKLSCLLAVAYV SSVALAVASVAVIHQSLGLSCTPTPGPPDLGLTSRCLLEPCIPSVPQCLPSPANVSSCLE GSTGLRSLWGSLLASLTPPPLPPPDPPAPPTPFHNCHLCQKLQRDSPTCHACHHPNRTAP TALSSPWYHTYGLAPPWPWSPVPASIPQPQQCSLFSIMELARLKSFIFPG
Uniprot No.

Target Background

Database Links
Protein Families
CNPPD1 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is CNPPD1 protein and what are its predicted functions?

    CNPPD1 (Cyclin Pas1/PHO80 Domain Containing 1) is a protein coding gene that has been identified in various species, including Pongo abelii (Sumatran orangutan). According to genomic databases, CNPPD1 is predicted to enable cyclin-dependent protein serine/threonine kinase regulator activity and is involved in the regulation of cyclin-dependent protein serine/threonine kinase activity . It is predicted to be an integral component of membrane and part of the cyclin-dependent protein kinase holoenzyme complex, with activity primarily in the nucleus .

    The gene is identified by several external IDs:

    DatabaseIdentifier
    HGNC25220
    NCBI Gene27013
    EnsemblENSG00000115649
    UniProtKB/Swiss-ProtQ9BV87 (human) / Q5R4U5 (Pongo abelii)
  • What are the optimal storage conditions for recombinant CNPPD1 protein?

    For successful experimental work with recombinant Pongo abelii CNPPD1 protein, proper storage is critical to maintain structural integrity and biological activity. According to product specifications, the recommended storage conditions are :

    Storage ConditionRecommendation
    Standard storage-20°C
    Extended storage-20°C or -80°C
    Working aliquots4°C for up to one week
    Buffer compositionTris-based buffer with 50% glycerol, optimized for this protein
    Important noteRepeated freezing and thawing is not recommended

    These conditions are designed to preserve protein stability and activity. Following these guidelines will help ensure reliable experimental results and reproducibility in research settings.

  • How is recombinant CNPPD1 protein typically produced for research purposes?

    Production of recombinant CNPPD1 protein for research typically follows established protocols for recombinant protein expression and purification. While specific details for CNPPD1 production are not explicitly stated in the search results, the standard methodological approach would involve:

    1. Gene Cloning: The CNPPD1 gene sequence is cloned into an appropriate expression vector with a promoter suitable for the chosen expression system.

    2. Expression System Selection: Based on available data, expression systems capable of proper protein folding and post-translational modifications would be selected. The expression region for CNPPD1 encompasses positions 1-410 .

    3. Protein Expression: The recombinant construct is transformed/transfected into the expression host (bacterial, yeast, insect, or mammalian cells) and protein expression is induced.

    4. Purification Strategy: The protein is typically purified using affinity chromatography based on a tag system determined during the production process .

    5. Quality Control: The purified protein undergoes quality checks for purity, integrity, and functionality before being formulated in a Tris-based buffer with 50% glycerol .

    This methodological approach helps ensure the production of high-quality recombinant protein suitable for various research applications.

Advanced Research Questions

  • How is CNPPD1 associated with cancer progression and what are its clinical implications?

    Research has identified CNPPD1 as having significant associations with cancer progression, particularly in oral squamous cell carcinoma (OSCC). A comprehensive genomic and transcriptomic analysis of OSCC revealed important correlations between CNPPD1 expression and perineural invasion (PNI), which is a critical prognostic factor .

    The study findings revealed that CNPPD1 was significantly enriched in the group without PNI and showed significant results in multivariate Cox analyses . This suggests that CNPPD1 may have protective effects against perineural invasion in OSCC patients.

    The table below summarizes the findings related to CNPPD1 and other genes in relation to PNI in OSCC:

    Gene CategoryAssociationStatistical SignificanceExamples
    CNPPD1Enriched in group without PNISignificant in multivariate Cox analysesSingle gene finding
    Genes enriched in PNI groupAssociated with increased perineural invasionSignificant adjustment for clinical variablesANKRD18B, ZNF699, UBE2E3, ZNF554, VASN, IGKV1-17, PCDHGC4, GPAM, SORCS2, FLI1, RAB2A
    Genes showing marginal trendsMay influence prognosisp = 0.06-0.09, HR = 0.15-1.43RPS6KA4, POTEM, TYRO3

    These findings position CNPPD1 as a potential biomarker for OSCC progression and suggest its possible role as a protective factor against perineural invasion, which has significant implications for understanding disease mechanisms and potentially developing new therapeutic approaches.

  • What methodological approaches can be used to study CNPPD1 in feedback regulation mechanisms?

    Investigating CNPPD1's role in feedback regulation mechanisms requires sophisticated methodological approaches. Based on established research paradigms in cellular signaling studies, the following methodological framework can be employed:

    1. Computational Modeling: Systematic computational analysis can identify potential feedback loops involving CNPPD1. This approach might utilize:

      • Three-tiered signaling cascade models incorporating CNPPD1

      • Parameter optimization using evolutionary algorithms (EA) followed by approximate Bayesian computation sequential Monte Carlo (ABC SMC) methods

      • Model comparison to identify the most likely feedback mechanisms

    2. Experimental Validation Pipeline:

      • Generate model predictions about system behavior under various perturbations

      • Design stimulus profiles that produce different behaviors in different models

      • Measure dynamic responses to discriminate between competing models

      • Refine models based on experimental findings

    3. Specific Experimental Techniques:

      • Phosphorylation state monitoring using Western blotting or phosphoproteomics

      • Real-time monitoring of signaling dynamics using fluorescent reporters

      • Genetic manipulations (knockouts, knockdowns) of CNPPD1 and related pathway components

      • Pharmacological interventions to perturb specific pathway nodes

    This methodological framework, similar to approaches used in studying MAPK pathway feedback mechanisms , provides a systematic way to elucidate CNPPD1's role in cellular signaling feedback loops.

  • How does CNPPD1 potentially interact with other proteins in signaling cascades?

    Understanding CNPPD1's interactions within signaling cascades requires integrating various experimental and computational approaches. Based on its predicted function in cyclin-dependent protein kinase regulation and the methodologies used in signaling pathway research, the following investigative strategy is recommended:

    1. Protein-Protein Interaction Identification:

      • Affinity purification coupled with mass spectrometry (AP-MS) to identify CNPPD1 binding partners

      • Proximity-dependent biotin identification (BioID) or APEX2-based proximity labeling to capture transient interactions

      • Yeast two-hybrid screening to identify direct interactors

    2. Interaction Validation and Characterization:

      • Co-immunoprecipitation experiments to confirm interactions

      • FRET or BRET assays to demonstrate proximity in living cells

      • Domain mapping to identify specific interaction regions

    3. Functional Significance Assessment:

      • Kinase activity assays to measure the impact of CNPPD1 on cyclin-dependent kinase function

      • Pathway reporter assays to measure signaling output

      • Phosphoproteomics to identify changes in phosphorylation patterns upon CNPPD1 perturbation

    4. Integration into Signaling Models:

      • Mathematical modeling of signaling cascades incorporating CNPPD1 interactions

      • Sensitivity analysis to identify critical interaction nodes

      • Model-driven experimental design to test predictions about system behavior

    This comprehensive approach would provide insights into how CNPPD1 functions within the context of broader signaling networks, particularly in its predicted role as a regulator of cyclin-dependent protein kinases.

  • What experimental designs are optimal for investigating the role of CNPPD1 in disease progression?

    To investigate CNPPD1's role in disease progression, particularly in cancer contexts where it has shown significant associations , the following experimental design framework is recommended:

    1. Clinical Cohort Studies:

      • Retrospective analysis of CNPPD1 expression in patient samples correlated with clinical outcomes

      • Prospective studies measuring CNPPD1 levels as potential biomarkers for disease progression

      • Multivariate Cox regression analyses adjusting for clinical variables such as age, stage, and treatment modality

    2. In Vitro Functional Studies:

      • Gain and loss of function experiments using overexpression and knockdown/knockout approaches

      • Cell migration, invasion, and proliferation assays to assess phenotypic changes

      • Co-culture systems to investigate cell-cell interactions (particularly relevant for perineural invasion studies)

    3. In Vivo Models:

      • Genetically engineered mouse models with modified CNPPD1 expression

      • Patient-derived xenograft models to study CNPPD1 in a more clinically relevant context

      • Orthotopic models specifically designed to study perineural invasion in OSCC

    4. Multi-omics Integration:

      Data TypeMethodOutcome Measure
      GenomicsWhole genome/exome sequencingCNPPD1 mutations and copy number variations
      TranscriptomicsRNA-seq, qRT-PCRExpression levels and splice variants
      ProteomicsMass spectrometry, Western blottingProtein levels and post-translational modifications
      MetabolomicsMass spectrometry, NMRMetabolic pathway alterations
      Clinical dataStatistical modelingCorrelation with disease outcomes
    5. Temporal Dynamics Assessment:

      • Time-course experiments to capture dynamic changes in CNPPD1 function

      • Stimulus-response studies similar to those used in pathway modeling

      • Single-cell analyses to capture heterogeneity in response

    This comprehensive experimental design approach would provide multi-dimensional insights into CNPPD1's role in disease progression and identify potential therapeutic opportunities.

  • How can computational models be used to predict CNPPD1 structure and function?

    Computational approaches provide powerful tools for predicting protein structure and function, particularly valuable for proteins like CNPPD1 where experimental structural data may be limited. A comprehensive computational pipeline would include:

    1. Sequence-Based Analysis:

      • Multiple sequence alignment with orthologs to identify conserved residues

      • Domain prediction using tools like InterPro and SMART

      • Motif identification for post-translational modifications and binding sites

    2. Structural Prediction:

      • Ab initio modeling for novel domains

      • Homology modeling based on structurally characterized cyclin domains

      • Molecular dynamics simulations to assess conformational flexibility

    3. Functional Prediction:

      Computational ApproachApplication to CNPPD1Expected Outcome
      Gene Ontology enrichmentAnalyze co-expressed genesPredict biological processes
      Network analysisIntegrate protein-protein interaction dataIdentify functional modules
      Evolutionary analysisCompare across speciesIdentify functionally constrained regions
      Molecular dockingSimulate interactions with CDKsPredict binding modes
      Mathematical modelingIncorporate into signaling networksPredict system-level behavior
    4. Model Validation Strategies:

      • Cross-validation using existing experimental data

      • Model-driven experimental design to test specific predictions

      • Iterative refinement based on new experimental findings

    5. Integration with Experimental Data:

      • Update models with proteomic and transcriptomic data

      • Refine predictions based on mutational analyses

      • Calibrate kinetic parameters using time-course measurements

    This computational approach would generate testable hypotheses about CNPPD1 structure and function, guiding subsequent experimental investigations and potentially revealing novel insights about its role in cellular processes.

  • What are the methodological considerations for studying post-translational modifications of CNPPD1?

    Post-translational modifications (PTMs) can significantly impact protein function, and studying them requires specific methodological considerations. For CNPPD1, which functions in regulatory contexts , PTMs may be particularly important. The following methodological framework is recommended:

    1. PTM Identification Strategy:

      • Mass spectrometry-based proteomics (particularly phosphoproteomics, given CNPPD1's role in kinase regulation)

      • Site-specific antibodies for common modifications (phosphorylation, ubiquitination)

      • Chemical labeling approaches for specific PTMs

    2. Site-Specific Characterization:

      • Site-directed mutagenesis of predicted modification sites

      • Functional assays comparing wild-type and mutant proteins

      • Temporal dynamics of modifications using pulse-chase approaches

    3. Regulatory Enzyme Identification:

      • Candidate approach based on prediction algorithms

      • Screening approaches using kinase/phosphatase libraries

      • Proximity labeling to identify modifying enzymes in cellular context

    4. Functional Impact Assessment:

      PTM TypeMethodological ApproachExpected Outcome Measure
      PhosphorylationPhosphomimetic/phosphodead mutationsChanges in protein-protein interactions
      UbiquitinationProteasome inhibitors, mutational analysisProtein stability and turnover
      AcetylationHDAC inhibitors, acetyl-mimetic mutationsSubcellular localization changes
      GlycosylationGlycosidase treatments, site mutationsImpact on membrane localization
      Proteolytic processingN- or C-terminal tagging, fragment analysisIdentification of functional domains
    5. Integrative Analysis:

      • Correlation of PTM patterns with cellular states

      • System-level modeling incorporating dynamic modifications

      • Integration with transcriptional and translational regulation data

    This comprehensive approach would provide insights into how PTMs regulate CNPPD1 function and potentially reveal mechanisms that could be targeted for therapeutic intervention in disease contexts.

  • How can single-cell approaches be applied to study CNPPD1 heterogeneity in tissue samples?

    Single-cell approaches offer powerful tools to investigate protein heterogeneity within complex tissues, which is particularly relevant for understanding CNPPD1's role in cancer contexts . The following methodological framework integrates cutting-edge single-cell technologies:

    1. Single-Cell Isolation and Analysis Techniques:

      • Laser capture microdissection for spatially resolved sampling

      • Fluorescence-activated cell sorting (FACS) for marker-based isolation

      • Single-cell RNA sequencing (scRNA-seq) for transcriptome profiling

      • Mass cytometry (CyTOF) for protein-level quantification

    2. Spatial Context Preservation:

      • Spatial transcriptomics to map gene expression within tissue architecture

      • Multiplexed immunofluorescence to quantify protein levels in situ

      • Digital spatial profiling for highly multiplexed protein quantification

    3. Analytical Frameworks:

      Analysis ApproachApplication to CNPPD1Expected Insight
      Clustering analysisIdentify cell populations with distinct CNPPD1 expressionCell type-specific patterns
      Trajectory inferenceMap CNPPD1 expression changes during disease progressionTemporal dynamics
      Cell-cell interaction analysisCorrelate CNPPD1 with intercellular communicationMicroenvironment interactions
      Spatial statisticsQuantify CNPPD1 distribution relative to anatomical featuresRelationship to perineural invasion
      Multi-modal integrationCombine RNA, protein, and epigenetic dataRegulatory mechanisms
    4. Validation and Functional Characterization:

      • Single-cell derived organoids to validate functional heterogeneity

      • Lineage tracing to track cells with varying CNPPD1 expression

      • CRISPR-based perturbations at single-cell resolution

    5. Clinical Correlation:

      • Integration with clinical outcomes to identify prognostic cell states

      • Comparison between primary and metastatic samples

      • Analysis of treatment-responsive versus resistant populations

    This comprehensive single-cell approach would provide unprecedented insights into CNPPD1 heterogeneity in disease contexts, potentially revealing new therapeutic targets and biomarkers.

  • What are the emerging technologies that could advance CNPPD1 research?

    Several cutting-edge technologies hold promise for advancing our understanding of CNPPD1 function and regulation. Based on current trends in protein research, the following emerging technologies should be considered:

    1. Advanced Structural Biology Techniques:

      • Cryo-electron microscopy to resolve CNPPD1 structure in native complexes

      • Hydrogen-deuterium exchange mass spectrometry for dynamic structural analysis

      • Integrative structural biology approaches combining multiple data types

    2. Genome Engineering and High-Throughput Screening:

      • CRISPR-Cas9 base editing for precise genomic modifications

      • CRISPR activation/interference screens to identify regulatory pathways

      • Perturb-seq combining genetic perturbations with single-cell readouts

    3. Live-Cell Imaging and Biosensors:

      TechnologyApplication to CNPPD1 ResearchPotential Insight
      FRET/BRET biosensorsMonitor CNPPD1 interactions or conformational changesReal-time activity dynamics
      OptogeneticsSpatiotemporally control CNPPD1 activityAcute vs. chronic effects
      Live-cell super-resolutionTrack CNPPD1 localization at nanoscaleSubcellular compartmentalization
      Correlative light-electron microscopyConnect function to ultrastructureStructural context of activity
      4D cell biologyTrack dynamic processes across space and timeComplex regulatory patterns
    4. Systems Biology Approaches:

      • Multi-omics integration for comprehensive pathway mapping

      • Digital cell models incorporating CNPPD1 signaling

      • Network-based drug discovery targeting CNPPD1 pathways

    5. Translational Technologies:

      • Patient-derived organoids for personalized disease modeling

      • Liquid biopsy approaches to monitor CNPPD1-related biomarkers

      • AI-driven analysis of CNPPD1 patterns in large clinical datasets

    These emerging technologies provide unprecedented opportunities to advance CNPPD1 research from fundamental understanding to clinical application, potentially accelerating the development of new therapeutic strategies based on CNPPD1 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.