Recombinant Pongo abelii Protein cornichon homolog (CNIH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNIH1; CNIH; Protein cornichon homolog 1; CNIH-1; Cornichon family AMPA receptor auxiliary protein 1; Protein cornichon homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-144
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
CNIH1
Target Protein Sequence
MAFTFAAFCYMLALLLTATLIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHA FFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGW CKLAFYLLAFFYYLYGMIYVLVSS
Uniprot No.

Target Background

Function

Involved in the selective transport and maturation of TGF-alpha family proteins.

Database Links
Protein Families
Cornichon family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane.

Q&A

What is the basic structure and function of Pongo abelii Protein Cornichon Homolog?

Pongo abelii Protein Cornichon Homolog (CNIH) is a transmembrane protein that functions primarily as a cargo receptor in the secretory pathway. The protein consists of 144 amino acids with a characteristic IFXXL sequence motif that serves as an interaction site with COPII components . CNIH proteins have a conserved structure across species, featuring transmembrane domains and a C-terminus that contains several potential phosphorylation sites . Functionally, CNIH proteins facilitate the transport of specific cargo proteins from the endoplasmic reticulum through COPII vesicles to the Golgi apparatus and eventually to their target membranes . In neuronal contexts, cornichon proteins also act as auxiliary proteins for AMPA receptors, influencing receptor trafficking and signaling properties .

How do CNIH proteins differ from CNIH4 in Pongo abelii?

The primary difference between CNIH and CNIH4 in Pongo abelii lies in their amino acid sequences and potentially their cargo specificity. CNIH (UniProt: Q5RDB5) consists of 144 amino acids with the sequence beginning with "MAFTFAAFCY" , while CNIH4 (UniProt: Q5R9M4) comprises 139 amino acids starting with "MEAVVFVFSL" . These sequence differences likely confer specificity in their interactions with different cargo proteins. While both function in the secretory pathway, they may have evolved to recognize and transport distinct membrane proteins, similar to how CNIH2 in plants specifically functions as a cargo receptor for the auxin efflux carrier PINA . The structural divergence between these homologs suggests functional specialization that has been maintained through evolutionary conservation across species.

How are cornichon proteins evolutionarily conserved across species?

Cornichon proteins demonstrate remarkable evolutionary conservation from yeast to vertebrates, indicating their fundamental importance in cellular trafficking processes. Phylogenetic analyses show that cornichon proteins cluster into three main groups: chlorophyte algae (Group A), higher plants (Group P), and fungi (Group F) . The conserved IFXXL motif (which appears as IFRTL in yeast and IFX/NL in plants) is critical for interaction with the COPII component SEC24p . This conservation extends to mammals, including Pongo abelii, where cornichon homologs maintain their core function as cargo receptors. Despite this functional conservation, species-specific adaptations exist, such as the extended C-terminus with phosphorylation residues found in plant CNIH proteins . This evolutionary pattern demonstrates how a fundamental cellular mechanism has been preserved while allowing for specialization within different biological contexts.

What are the optimal storage conditions for recombinant Pongo abelii CNIH proteins?

For optimal maintenance of recombinant Pongo abelii CNIH protein activity, storage conditions must be carefully controlled. The protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for routine storage, while extended storage necessitates conservation at -80°C . It is critical to avoid repeated freeze-thaw cycles as these can cause protein degradation and loss of functionality . For ongoing experiments, prepare working aliquots and store them at 4°C for no longer than one week . The storage buffer is specifically optimized for this protein to maintain stability, with the high glycerol concentration preventing ice crystal formation that could disrupt protein structure. When handling the protein, minimize exposure to room temperature and use cold blocks during experimental setup to preserve integrity of the recombinant protein.

How can researchers verify the functionality of recombinant CNIH proteins in experimental systems?

Verification of recombinant CNIH protein functionality requires multiple complementary approaches:

  • Protein-Protein Interaction Assays: Employ the mating-based split ubiquitin system (mbSUS) designed for membrane proteins to assess interactions with known cargo proteins . Strong interactions can be quantified by growth on selection medium and β-galactosidase activity .

  • Bimolecular Fluorescence Complementation (BiFC): Use BiFC in expression systems such as Nicotiana benthamiana epidermal cells to visualize protein interactions in cellular contexts . Functional CNIH proteins should show interactions on reticulated structures resembling the ER and in puncta throughout the cytoplasm .

  • Trafficking Assays: Monitor the ability of CNIH to facilitate transport of cargo proteins by expressing fluorescently tagged cargo proteins (e.g., PIN transporters) and observing their localization in the presence and absence of functional CNIH .

  • Phenotypic Rescue Experiments: In mutant systems lacking endogenous CNIH, introduction of recombinant CNIH should restore normal trafficking of cargo proteins and rescue associated phenotypes if the recombinant protein is functional .

These methodologies collectively provide robust validation of recombinant CNIH functionality in experimental systems.

What experimental controls should be included when studying CNIH protein interactions?

When studying CNIH protein interactions, the following experimental controls are essential:

  • Positive Interaction Controls: Include well-established protein interactions, such as the homo-oligomerization of aquaporin AtPIP2 , to validate that your interaction detection system is functioning properly.

  • Negative Interaction Controls: Employ proteins known not to interact with your protein of interest, such as co-expression of two unrelated plasma membrane proteins (e.g., auxin transporter and aquaporin) , to establish background signal levels and confirm specificity.

  • Empty Vector Controls: Include constructs containing only the tags or reporter domains without the proteins of interest to identify any tag-mediated or non-specific interactions.

  • Expression Level Controls: Monitor and normalize for protein expression levels, as overexpression can lead to artifactual interactions. Western blots with tag-specific antibodies should be used to quantify expression.

  • Subcellular Localization Controls: Confirm that the proteins being tested co-localize in the same cellular compartments where interaction is expected to occur.

  • Mutant Variants: Test interaction with mutated versions of CNIH (particularly in the IFXXL motif) to validate the specificity of observed interactions and identify critical binding domains.

These controls collectively ensure that observed interactions are specific, reproducible, and biologically relevant.

How does CNIH2 regulate auxin transport and what methodologies reveal this function?

CNIH2 regulates auxin transport by functioning as a specific cargo receptor for the auxin efflux carrier PINA, controlling its trafficking and membrane localization . This regulatory mechanism was elucidated through multiple complementary methodologies:

  • Mutant Analysis: CNIH2 deletion mutants (Δcnih2) exhibited phenotypes similar to PIN transporter mutants, including altered caulonemal development and larger gametophores, suggesting a functional relationship between CNIH2 and PIN proteins .

  • Protein-Protein Interaction Assays: The mating-based split ubiquitin system (mbSUS) demonstrated that CNIH2 interacts more strongly with PINA than CNIH1, as evidenced by enhanced growth on selection medium and higher β-galactosidase activity .

  • Bimolecular Fluorescence Complementation (BiFC): This technique confirmed the interaction between CNIH2 and PINA on ER-like reticulated structures and cytoplasmic puncta in Nicotiana benthamiana epidermal cells .

  • Fluorescent Protein Localization: In CNIH2 deletion mutants expressing PINA-EGFP, the localization of PINA was altered, demonstrating that CNIH2 is necessary for proper PINA trafficking to its membrane of residence .

These methodological approaches collectively established that CNIH2 controls auxin transport by regulating the trafficking and localization of the PINA auxin efflux carrier, with the C-terminus of CNIH2 being particularly important for this function.

What is the significance of the C-terminus in CNIH protein function?

The C-terminus of CNIH proteins plays a crucial role in their function, particularly in determining cargo specificity and regulating protein interactions. Research has revealed that plant CNIH proteins possess an extended C-terminus with approximately 15 additional amino acids characterized by several putative phosphorylation residues . Phosphorylation prediction analysis using NetPhos3.1 identified three threonine residues (T145, T148, and T150) in CNIH1 as potential phosphorylation sites, while in CNIH2, only T148 is predicted as a potential phosphorylation site .

The functional significance of this region is demonstrated by its role in regulating the interaction, trafficking, and membrane localization of cargo proteins such as the auxin efflux carrier PINA . The C-terminus likely serves as a regulatory domain that can be modified through phosphorylation to modulate protein-protein interactions and trafficking efficiency in response to cellular signals. This post-translational regulation mechanism would allow for dynamic control of cargo transport through the secretory pathway, enabling cells to adapt to changing physiological conditions or developmental stages.

How do CNIH proteins interact with AMPA receptors and what are the functional consequences?

CNIH proteins, particularly CNIH3, interact with AMPA receptors (AMPARs) in a dual capacity - acting both as trafficking chaperones and as modulators of receptor function. CNIH3 functions as an AMPAR auxiliary protein that facilitates the transport of AMPARs from the endoplasmic reticulum and Golgi to the post-synaptic density . This chaperone function ensures proper delivery of AMPARs to their site of action at the postsynaptic membrane.

Beyond trafficking, CNIH proteins remain associated with AMPARs at the postsynaptic membrane where they potentiate AMPAR glutamate sensitivity . This functional modulation is critical for synaptic plasticity, as AMPARs are key components of hippocampal synaptic plasticity and memory formation .

The functional consequence of this interaction is demonstrated in behavioral studies where CNIH3 knockout mice (Cnih3-/-) show impaired spatial memory, particularly in females . Conversely, overexpression of CNIH3 in the dorsal hippocampus enhances spatial memory performance in female mice . These findings reveal that CNIH proteins not only ensure proper AMPAR localization but also modulate their signaling properties in a way that impacts higher cognitive functions like spatial memory, with intriguing sex-specific effects that suggest differential regulation or importance of these pathways between males and females.

How can CRISPR-Cas9 be utilized to study CNIH function in model organisms?

CRISPR-Cas9 technology offers sophisticated approaches for dissecting CNIH function in model organisms through targeted genetic manipulation. Researchers can implement the following strategies:

  • Generation of Null Mutants: Complete knockout of CNIH genes can be achieved by introducing frameshift mutations that create premature stop codons, as demonstrated in the creation of the cnih1 mutant where an in-frame premature stop codon at nucleotide position 132 resulted in a truncated 42 amino acid peptide .

  • Domain-Specific Modifications: Targeted mutations in specific functional domains, such as the IFXXL motif involved in COPII interaction or phosphorylation sites in the C-terminus, can elucidate the importance of these regions for CNIH function .

  • Reporter Gene Knock-in: CRISPR can be used to insert fluorescent reporter genes at the endogenous CNIH locus to monitor native expression patterns and protein localization without overexpression artifacts.

  • Conditional Knockouts: Implementation of Cre-lox or similar systems with CRISPR can generate tissue-specific or temporally controlled CNIH deletions to study context-dependent functions.

  • Homology-Directed Repair for Precise Modifications: Researchers can introduce specific amino acid substitutions to test hypotheses about phosphorylation sites or interaction domains .

  • Multiplexed Editing: Simultaneous targeting of multiple CNIH homologs (e.g., CNIH1 and CNIH2) can reveal functional redundancy or unique roles of each protein .

When applying these approaches, it is essential to validate editing efficiency, screen for off-target effects, and include appropriate controls such as reintroduction of wild-type CNIH to confirm phenotypic rescue.

What are the sex-specific effects of CNIH3 on spatial memory and how can they be studied?

CNIH3 exhibits intriguing sex-specific effects on spatial memory, with differential impacts in male and female mice. Female Cnih3-/- mice show significant impairment in spatial memory tasks, making more primary errors, exhibiting higher primary latency, and taking less efficient routes to targets in the Barnes maze compared to wild-type females . Conversely, male Cnih3-/- mice show no significant changes in spatial memory performance . Furthermore, overexpression of Cnih3 in the dorsal hippocampus enhances spatial memory in females but not males .

To comprehensively study these sex-specific effects, researchers should employ:

  • Balanced Experimental Design: Include adequate numbers of both male and female subjects in all experimental groups, analyzed separately to detect sex-specific effects.

  • Hormonal Considerations: Evaluate the role of sex hormones by including ovariectomized females and castrated males with and without hormone replacement.

  • Developmental Timeline Analysis: Examine whether sex differences emerge during specific developmental periods by testing animals at different ages.

  • Cellular and Molecular Approaches:

    • Compare CNIH3 expression levels and patterns between sexes using qPCR and immunohistochemistry

    • Analyze sex differences in AMPAR composition and trafficking using biochemical fractionation

    • Employ electrophysiology to assess sex differences in synaptic plasticity mechanisms

  • Circuit-Specific Manipulations: Use optogenetics or chemogenetics to determine if specific hippocampal circuits are differentially affected by CNIH3 in males versus females.

This multifaceted approach will help elucidate the mechanisms underlying sexually dimorphic effects of CNIH3 on spatial memory and hippocampal function.

How can viral vector-based approaches be optimized for studying CNIH function in vivo?

Optimization of viral vector-based approaches for studying CNIH function in vivo requires strategic consideration of multiple factors:

  • Vector Selection: AAV5 has been successfully used for CNIH3 overexpression in the dorsal hippocampus , but vector selection should be tailored to:

    • Target cell type (neuronal vs. glial)

    • Required packaging capacity for the CNIH gene plus regulatory elements

    • Blood-brain barrier penetrance if systemic delivery is desired

  • Promoter Optimization:

    • Cell-type specificity: Use CaMKII promoters for excitatory neurons as demonstrated in CNIH3 studies

    • Expression level control: Consider using inducible promoters (e.g., tetracycline-responsive) to modulate expression timing and intensity

    • Developmental regulation: Select promoters active during specific developmental windows if studying age-dependent effects

  • Construct Design Features:

    • Include fluorescent reporters (e.g., YFP) as expression markers and for co-localization studies

    • Incorporate epitope tags for biochemical analysis while ensuring they don't interfere with CNIH function

    • Design multiple constructs with different tag positions to verify consistent results

  • Delivery Parameters:

    • Injection coordinates: Precisely target relevant brain regions (e.g., dorsal hippocampus for spatial memory studies)

    • Infusion rate: Optimize for minimal tissue damage while ensuring adequate distribution

    • Recovery time: Allow sufficient time post-injection before behavioral testing (typically 3-4 weeks)

  • Controls and Validation:

    • Empty vector or fluorescent protein-only controls

    • Verification of expression using immunohistochemistry and Western blotting

    • Functional validation through electrophysiology or trafficking assays

These optimized approaches enable precise manipulation of CNIH expression in specific cell populations and brain regions, facilitating detailed investigation of its function in complex behaviors and physiological processes.

How do CNIH proteins from Pongo abelii compare functionally to those in other model organisms?

CNIH proteins demonstrate both conserved core functions and species-specific adaptations across evolutionary lineages. Comparing Pongo abelii CNIH proteins with those from other organisms reveals important functional insights:

  • Conservation of Core Trafficking Functions:

    • The fundamental role of CNIH as a cargo receptor in the COPII-mediated secretory pathway is preserved from yeast (ERV14) to mammals, including Pongo abelii

    • The critical IFXXL motif that mediates interaction with SEC24 of the COPII complex is maintained across species, though with slight variations (IFRTL in yeast, IFX/NL in plants)

  • Species-Specific Cargo Selection:

    • In yeast, ERV14 (CNIH homolog) transports Axl2p protein necessary for axial polarity

    • In Drosophila, Cni is required for transport of the growth factor Gurken during oogenesis

    • In plants (Physcomitrium patens), CNIH2 specifically transports the auxin efflux carrier PINA

    • In mammals, including likely in Pongo abelii, CNIH proteins transport and modulate AMPA receptors

  • Structural Adaptations:

    • Plant CNIH proteins possess an extended C-terminus with phosphorylation sites not present in fungal homologs

    • Pongo abelii CNIH likely shares the structural features of mammalian CNIHs, positioned between the simpler yeast form and the specialized plant form

  • Functional Specialization:

    • In mammals, CNIH proteins have evolved dual roles as both trafficking chaperones and functional modulators of AMPARs at the synapse

    • This represents an evolutionary adaptation where a trafficking protein has acquired additional signaling functions

This comparative analysis demonstrates how a fundamental cellular mechanism has been preserved through evolution while allowing for specialization to meet the specific needs of different organisms and cell types.

What can mouse CNIH3 studies tell us about potential functions in primates like Pongo abelii?

Mouse CNIH3 studies offer valuable insights into potential CNIH functions in primates, including Pongo abelii, while acknowledging important caveats about cross-species extrapolation:

  • Conserved Neuronal Functions:

    • CNIH3's role in trafficking AMPARs to postsynaptic membranes and potentiating AMPAR signaling in mice likely represents a conserved function in primates given the fundamental importance of glutamatergic transmission across mammals

    • The concentrated expression of CNIH3 in the dorsal hippocampus of mice suggests similar regional specialization may exist in the primate brain

  • Cognitive and Behavioral Implications:

    • The impact of CNIH3 on spatial memory in mice indicates that primate CNIH proteins may similarly influence hippocampal-dependent cognitive processes

    • Sex-specific effects observed in mice raise the possibility that hormonal regulation of CNIH function may also occur in primates

  • Evolutionary Adaptations to Consider:

    • Primate brains have undergone significant expansion and specialization, particularly in cortical regions, potentially leading to additional or modified CNIH functions

    • The longer lifespan and extended developmental period in primates may result in different temporal dynamics of CNIH action

  • Methodological Translation:

    • Viral vector approaches successful in mice could be adapted for non-human primate studies with appropriate modifications for larger brain volumes and different stereotaxic coordinates

    • The Barnes maze paradigm used in mice would need to be adapted to primate-appropriate cognitive testing methods

  • Clinical Relevance:

    • Mouse findings suggesting CNIH3's role in memory point to potential involvement of primate CNIH proteins in cognitive disorders, making them possible therapeutic targets

These extrapolations from mouse studies provide testable hypotheses about CNIH function in primates, while recognizing that direct studies in non-human primates would be necessary to confirm these potential roles.

How do plant and animal CNIH proteins differ in structure and function?

Plant and animal CNIH proteins exhibit both significant conservation and notable divergence in their structure and function:

This comparative analysis highlights how a conserved protein family has evolved distinct structural features and functional specializations while maintaining its core role in the secretory pathway across vastly different biological kingdoms.

What are common challenges in expressing and purifying functional recombinant CNIH proteins?

Expressing and purifying functional recombinant CNIH proteins presents several challenges due to their nature as multi-pass transmembrane proteins:

  • Membrane Protein Solubilization:

    • Challenge: CNIH proteins contain transmembrane domains that make them inherently hydrophobic and difficult to solubilize while maintaining native conformation.

    • Solution: Optimize detergent screening (starting with mild detergents like DDM or LMNG) and consider using amphipols or nanodiscs for maintaining native-like membrane environments during purification.

  • Expression System Selection:

    • Challenge: Traditional E. coli systems often lack appropriate membrane insertion machinery and post-translational modifications for mammalian membrane proteins.

    • Solution: Utilize eukaryotic expression systems like insect cells (Sf9, High Five), yeast (Pichia pastoris), or mammalian cells (HEK293, CHO) that provide appropriate membrane biology and glycosylation machinery.

  • Protein Misfolding and Aggregation:

    • Challenge: Overexpression can lead to misfolding and formation of inclusion bodies.

    • Solution: Reduce expression temperature (16-20°C), use solubility-enhancing fusion tags (SUMO, MBP), and consider codon optimization for the expression host.

  • Maintaining Functionality:

    • Challenge: Purification processes may disrupt protein-lipid interactions essential for CNIH function.

    • Solution: Include lipid mixtures resembling native membranes during purification and storage, and verify functionality through interaction assays with known cargo proteins.

  • Low Yield:

    • Challenge: Membrane proteins typically express at lower levels than soluble proteins.

    • Solution: Scale up cultivation volume, optimize induction parameters, and consider stable cell lines for mammalian expression.

  • Protein Stability:

    • Challenge: CNIH proteins may be unstable once removed from their native membrane environment.

    • Solution: Store in optimized buffer conditions with 50% glycerol at -20°C or -80°C , avoid freeze-thaw cycles, and use freshly prepared protein for critical experiments.

  • Verification of Correct Folding:

    • Challenge: Assessing proper folding of membrane proteins is difficult.

    • Solution: Employ circular dichroism spectroscopy to verify secondary structure, and use functional assays like cargo protein binding to confirm biological activity.

Addressing these challenges requires an integrated approach that combines appropriate expression systems, optimization of buffer conditions, and careful quality control throughout the purification process.

How can researchers distinguish between the trafficking and signaling functions of CNIH proteins?

Distinguishing between the trafficking and signaling functions of CNIH proteins requires sophisticated experimental approaches that can separate these interrelated processes:

  • Domain-Specific Mutations:

    • Create targeted mutations in distinct functional domains: the IFXXL motif critical for COPII interaction (trafficking function) versus regions that interact with cargo proteins' signaling domains

    • Compare phenotypes resulting from these specific mutations to identify which cellular processes are affected by each function

  • Temporal Separation Approaches:

    • Employ rapid inducible systems (e.g., light-inducible or chemical-inducible) to activate CNIH at different stages of cargo protein life cycle

    • Acutely inhibit trafficking machinery using pharmacological approaches (e.g., Brefeldin A) after cargo delivery to isolate post-trafficking functions

  • Trafficking-Deficient Variants:

    • Engineer CNIH variants that can bind cargo but cannot engage with COPII machinery

    • Express these variants directly at the target membrane (e.g., postsynaptic membrane for AMPARs) to assess signaling functions independent of trafficking

  • Biochemical Pathway Analysis:

    • Use quantitative phosphoproteomics to identify signaling pathways activated by CNIH independent of its trafficking function

    • Compare signaling events in cells expressing trafficking-competent versus trafficking-deficient CNIH variants

  • Visualization Strategies:

    • Employ dual-color live imaging with differentially labeled CNIH and cargo proteins

    • Use pulse-chase approaches with photoconvertible fluorescent proteins to distinguish newly trafficked versus previously delivered cargo

  • Cargo Mutant Analysis:

    • Create cargo protein variants (e.g., AMPAR subunits) that can still signal but have modified CNIH interaction sites

    • Compare these to variants that interact with CNIH but have impaired signaling domains

  • Electrophysiological Approaches (for AMPAR interactions):

    • Perform rapid local perfusion of glutamate to activate AMPARs while monitoring changes in kinetics and current amplitude

    • Compare responses in neurons expressing full-length CNIH versus truncated versions that maintain only trafficking or signaling functions

These complementary approaches can help researchers delineate the dual roles of CNIH proteins and understand how these functions are integrated in various cellular contexts.

What analytical techniques are most effective for studying CNIH-mediated protein trafficking in cellular systems?

Studying CNIH-mediated protein trafficking in cellular systems requires a multifaceted analytical approach combining advanced imaging, biochemical, and genetic techniques:

  • Advanced Fluorescence Microscopy:

    • FRAP (Fluorescence Recovery After Photobleaching): Measures mobility and turnover rates of fluorescently-tagged cargo proteins in the presence or absence of CNIH

    • Pulse-Chase Imaging: Using photoconvertible fluorescent proteins (e.g., Dendra2) tagged to cargo proteins to track specific protein populations from synthesis through trafficking

    • Super-Resolution Microscopy (STED, PALM, STORM): Provides nanoscale resolution of CNIH and cargo protein co-localization in trafficking vesicles and target membranes

  • Live-Cell Trafficking Assays:

    • Time-lapse Confocal Microscopy: Track co-movement of fluorescently labeled CNIH and cargo proteins through the secretory pathway

    • Temperature-Synchronized Trafficking: Use temperature blocks (e.g., 15°C to block ER-to-Golgi transport) followed by temperature shifts to synchronize and monitor waves of protein trafficking

  • Biochemical Approaches:

    • Subcellular Fractionation: Isolate specific membrane compartments (ER, Golgi, plasma membrane) and quantify cargo protein distribution

    • Surface Biotinylation: Specifically label and quantify plasma membrane-localized cargo proteins to assess trafficking efficiency

    • Glycosylation Mapping: Monitor progressive glycosylation changes as proteins move through the secretory pathway

  • Interaction Analysis Techniques:

    • Co-immunoprecipitation: Assess physical interactions between CNIH and cargo proteins at different stages of trafficking

    • Proximity Labeling (BioID, APEX): Identify proteins in close proximity to CNIH during trafficking events

    • Split-Ubiquitin System: Specifically designed for membrane protein interactions as demonstrated in CNIH-PINA studies

  • Genetic Manipulation Strategies:

    • CRISPR-Cas9 Knockout/Knockin: Generate null mutants or fluorescently tagged endogenous proteins

    • Dominant-Negative Approaches: Express trafficking-deficient CNIH variants to disrupt endogenous function

    • Cargo-Specific Trafficking Reporters: Develop chimeric proteins containing trafficking signals of interest fused to reporter proteins

  • Quantitative Analysis Methods:

    • High-Content Imaging: Automated analysis of trafficking in large cell populations under various conditions

    • Mathematical Modeling: Develop kinetic models of protein movement through trafficking compartments

These techniques collectively provide a comprehensive toolkit for dissecting CNIH-mediated trafficking mechanisms in diverse cellular systems.

What are promising approaches for identifying novel cargo proteins of CNIH in Pongo abelii?

Identifying novel cargo proteins of CNIH in Pongo abelii requires innovative approaches that combine high-throughput screening with targeted validation:

  • Proximity-Based Proteomics:

    • Implement BioID or APEX2 proximity labeling by fusing these enzymes to CNIH proteins

    • Express in relevant cell types derived from orangutan samples or in appropriate surrogate systems

    • Perform mass spectrometry analysis to identify proteins that come into close proximity with CNIH during trafficking

  • Co-Immunoprecipitation Coupled with Mass Spectrometry:

    • Generate antibodies against Pongo abelii CNIH or use epitope-tagged versions

    • Immunoprecipitate CNIH complexes from tissues or cell lines under conditions that preserve transient interactions

    • Identify co-precipitated proteins through mass spectrometry, focusing on membrane proteins

  • Comparative Genomics and Evolutionary Analysis:

    • Identify proteins that show evolutionary rate covariation with CNIH across primate species

    • Focus on membrane proteins that may have co-evolved with CNIH as potential cargo

  • CNIH Knockout/Knockdown Proteomics:

    • Generate CNIH-deficient cell lines using CRISPR-Cas9

    • Compare plasma membrane proteomes between wild-type and CNIH-deficient cells to identify proteins whose surface expression depends on CNIH

  • Split-Ubiquitin Membrane Yeast Two-Hybrid Screening:

    • Use Pongo abelii CNIH as bait in a split-ubiquitin membrane yeast two-hybrid system

    • Screen against a library of Pongo abelii membrane proteins to identify potential interactors

  • Candidate Approach Based on Known Interactions:

    • Test interaction of CNIH with Pongo abelii orthologs of proteins known to be CNIH cargo in other species

    • Focus on AMPA receptor subunits, other neurotransmitter receptors, and transporters based on established precedents

  • Validation of Potential Cargo:

    • Confirm direct interaction using purified proteins in reconstituted systems

    • Demonstrate trafficking defects of candidate cargo in CNIH-deficient cells

    • Rescue trafficking with reintroduction of wild-type but not trafficking-deficient CNIH

These approaches would significantly advance our understanding of CNIH function in Pongo abelii and potentially reveal species-specific cargo proteins that have evolved in primates.

How might understanding CNIH function contribute to neurodegenerative disease research?

Understanding CNIH function could significantly impact neurodegenerative disease research through several interconnected pathways:

  • AMPAR Trafficking and Excitotoxicity:

    • CNIH proteins modulate AMPAR trafficking and function , and dysregulated AMPAR activity contributes to excitotoxicity in neurodegenerative conditions

    • Targeting CNIH-AMPAR interactions could provide novel approaches to mitigate excitotoxic damage in conditions like Alzheimer's disease, stroke, and amyotrophic lateral sclerosis

  • Synaptic Plasticity and Cognitive Decline:

    • CNIH3's role in spatial memory suggests involvement in cognitive processes that deteriorate in neurodegenerative diseases

    • Understanding how CNIH proteins maintain healthy synaptic function could reveal new therapeutic targets for preserving cognitive abilities

  • Protein Misfolding and Trafficking Defects:

    • Many neurodegenerative diseases involve protein misfolding and trafficking abnormalities

    • CNIH's role in the secretory pathway suggests it may influence proper folding and transport of disease-relevant proteins

    • Modulating CNIH function could potentially restore proper trafficking of proteins prone to misfolding

  • Sex-Specific Therapeutic Approaches:

    • The sexually dimorphic effects of CNIH3 on spatial memory align with observed sex differences in prevalence and progression of neurodegenerative diseases

    • This suggests potential for developing sex-specific therapeutic strategies targeting CNIH pathways

  • Neuroinflammation Control:

    • If CNIH proteins influence the trafficking of immune receptors or inflammatory mediators in glial cells, they could impact neuroinflammatory processes central to many neurodegenerative conditions

  • Biomarker Development:

    • Alterations in CNIH expression or function could serve as early biomarkers for synaptic dysfunction preceding overt neurodegeneration

    • Monitoring CNIH-dependent cargo trafficking could provide indicators of disease progression

  • Therapeutic Delivery Systems:

    • Understanding CNIH trafficking mechanisms could inform the development of novel delivery systems for therapeutic proteins or peptides to specific neuronal populations

These diverse contributions highlight how fundamental research on CNIH function could translate into clinical applications for neurodegenerative disease management, potentially leading to new diagnostic tools and therapeutic strategies.

What technological advances would most benefit CNIH protein research in the next five years?

Several emerging technological advances are poised to significantly accelerate CNIH protein research in the coming five years:

  • Cryo-Electron Microscopy Advances:

    • High-resolution structural determination of CNIH proteins in complex with their cargo partners

    • Visualization of conformational changes during the trafficking cycle

    • Implementation of time-resolved cryo-EM to capture transitional states during CNIH-mediated cargo loading and unloading

  • AI-Driven Protein Structure Prediction and Design:

    • Application of AlphaFold and similar AI systems to predict CNIH-cargo interactions with increasing accuracy

    • Design of modified CNIH proteins with enhanced specificity for therapeutic cargo delivery

    • Computational screening of molecules that could modulate CNIH-cargo interactions

  • Single-Cell Multi-Omics Integration:

    • Correlation of CNIH expression with cargo protein localization at single-cell resolution

    • Integration of transcriptomics, proteomics, and spatial information to map CNIH function across diverse cell types

    • Identification of cell type-specific CNIH regulatory networks

  • Advanced Genome Editing Technologies:

    • More precise CRISPR-based approaches for introducing specific mutations in CNIH functional domains

    • Base editing and prime editing for creating specific amino acid substitutions without double-strand breaks

    • Development of tissue-specific, inducible editing systems for temporal control of CNIH function

  • Organoid and Brain-on-Chip Technologies:

    • Study of CNIH function in human-derived brain organoids to better model primate-specific aspects

    • Implementation of microfluidic systems to study CNIH-dependent protein trafficking in controlled microenvironments

    • Development of patient-derived organoids to study CNIH in disease contexts

  • Advanced Live Imaging Technologies:

    • Super-resolution microscopy combined with adaptive optics for deep tissue imaging of CNIH trafficking in intact brain tissue

    • Expansion microscopy techniques to visualize nanoscale CNIH-cargo interactions

    • Voltage imaging combined with protein trafficking sensors to correlate CNIH-dependent AMPAR delivery with functional outcomes

  • Synthetic Biology Approaches:

    • Engineering synthetic CNIH variants with novel cargo specificities for targeted delivery applications

    • Development of optogenetic or chemogenetic CNIH controls for precise temporal manipulation of trafficking

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.