Recombinant Pongo abelii Protein FAM151A (FAM151A)

Shipped with Ice Packs
In Stock

Description

General Information

FAM151A, or Family With Sequence Similarity 151 Member A, is a protein-coding gene . The official gene symbol and full name are defined by the HGNC (HUGO Gene Nomenclature Committee) .

Pongo abelii refers to the Sumatran orangutan. Recombinant Pongo abelii Protein FAM151A would refer to the protein FAM151A produced using recombinant DNA technology, where the gene encoding the Pongo abelii protein is expressed in a host organism .

Key details:

  • Official gene symbol: FAM151A

  • Full gene name: family with sequence similarity 151, member A

  • NCBI Gene ID: 338094

  • HGNC ID: 25032

  • Ensembl ID: ENSG00000162391

Expression and Function

FAM151A is predicted to be located in the membrane and active in the extracellular space . It is found in extracellular exosomes . Studies on the rat Fam151a gene have shown that its expression can be influenced by various compounds, with some compounds increasing expression and others decreasing it .

Role in Cancer

FAM151A is associated with colorectal adenocarcinoma . The Human Protein Atlas provides detailed information regarding FAM151A expression in various cancer tissues, including antibody staining patterns and RNA expression data from The Cancer Genome Atlas (TCGA) . This resource also offers Kaplan-Meier plots showing the correlation between FAM151A mRNA expression and patient survival in different cancers .

Expression Regulation

Expression of the Fam151a gene can be affected by various factors. In rat studies, the expression of Fam151a mRNA is altered by exposure to different substances .

SubstanceEffect on FAM151A mRNA Expression
EndosulfanIncreased expression
Folic AcidIncreased expression
FonofosIncreased methylation
Hydrogen PeroxideAffects expression
LasiocarpineDecreased expression
Lipopolysaccharide with S-(1,2-dichlorovinyl)-L-cysteineIncreased expression
Methylarsonic acid, sodium arsenate, sodium arsenite, and Cacodylic AcidDecreased expression
N-NitrosopyrrolidineDecreased expression
O-methyleugenolDecreased expression
ParacetamolDecreased expression
ParaquatDecreased expression
ParathionIncreased methylation
Pirinixic acid (increased activity of PPARA protein)Increased expression
S-(1,2-dichlorovinyl)-L-cysteine with LipopolysaccharidesIncreased expression
Sodium arsenate, sodium arsenite, monomethylarsonic acid, and Cacodylic AcidDecreased expression
Sodium arseniteDecreased expression
TamoxifenIncreased expression
TerbufosIncreased methylation
ThioacetamideIncreased expression
TriptonideIncreased expression
UrethaneDecreased expression

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates. Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. The tag type will be determined during the production process. To request a specific tag type, please inform us; we will prioritize development of the specified tag.
Synonyms
FAM151A; Protein FAM151A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
FAM151A
Target Protein Sequence
MVCREQLSKNQVKWVFASITCVSAVAIAAIVLAITLRRPGCELEACSPDADMLDYLLSLG QISRRDALEVTWYHAANSKEAMTAALNSNITVLEADVNVEGLGTANETGVPIMAHPPAIY SDNTLEQWLDAVLGSSQKGIKLDFKNIKAVGPSLDLLRRLTEEGKVRRPIWINADILKGP NMLISTEVNATQFLALVREKYPKATLSPGWTTFYVSTSPNTTYTRAMVEKMHELVGGVPQ RVTFPVRSSMVRAAWPHFSWLLSQSERYSLTLWQAASDPMSVEDLLYVRDNTAVHQVYYD IFEPLLSQFKQLALNATRKPMYYTGGSLIPLLQLPGDDGLNVEWLVPDVQGSGKTATMTL PDTEGMILLNTGLEGTVSENPVPIVHTPSGSILTLESCLQQLATHPGHWGIHLQIAEPAA LRPSLALLARLSSLGLLHWPVWVGAKISHGSFSVPGHVAGRELLTAVAEVFPDVTVAPGW PEEVLGSGYREQLLTDMLELCQGLWQPVSFQMQAMLLGHSTAGAIARLLASSPRATVTVE YDPAGGDYASVRTALLAARAVDSTRVYYRLPQGYRKDLLADVGRN
Uniprot No.

Target Background

Database Links

KEGG: pon:100171831

UniGene: Pab.14398

Protein Families
FAM151 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is FAM151A and what are its key structural domains?

FAM151A (Family with sequence similarity 151 member A) is a transmembrane protein that contains three known domains: one transmembrane domain and two domains of unknown function (DUF2181). These DUF2181 domains belong to the GDPD/PLCD superfamily, which are known to hydrolyze glycerophosphodiester bonds. Based on homology analysis, the second DUF2181 of FAM151A is hypothesized to be nonfunctional . The molecular weight of FAM151A is approximately 95 kDa .

For researchers working with Pongo abelii (Sumatran orangutan) FAM151A protein, the full amino acid sequence is available from commercial sources and typically consists of 585 amino acids . The protein has a Uniprot accession number of Q5RDY9, which can be used to access additional structural information .

What are the expression patterns of FAM151A in tissues?

In humans, the mRNA transcript of FAM151A is expressed in the kidney, small intestine, and liver, while the FAM151A protein is only expressed in kidney tubules . This highly specific protein expression pattern suggests a specialized function in renal physiology.

Recent research has also identified FAM151A expression in β-cells, suggesting it may play a role in pancreatic function. Differential expression of FAM151A has been observed between hyperglycemic-obese, normoglycemic-obese, and normoglycemic-lean states, suggesting potential involvement in metabolic regulation .

What is known about the evolutionary conservation of FAM151A?

FAM151A has direct orthologs in chimpanzee, mouse, zebrafish, and other members of the clade Eumetazoa that diverged from humans up to around 700 million years ago. Interestingly, FAM151A does not have any known orthologs in birds .

FAM151A has one known paralog in humans, FAM151B, which contains only the first DUF2181 and lacks the transmembrane region. In mammals, both FAM151A and FAM151B are homologs of the C. elegans menorin gene, which is involved in dendrite branching . This evolutionary relationship provides clues about potential conserved functions across species.

What are optimal methods for producing recombinant FAM151A protein?

When working with recombinant Pongo abelii FAM151A protein, researchers should consider these methodological approaches:

  • Expression systems: While E. coli systems are commonly used, they may not provide proper post-translational modifications. For functional studies of FAM151A, mammalian or insect cell expression systems are recommended due to the protein's transmembrane domain and potential glycosylation sites .

  • Purification strategy: A two-step purification process is recommended:

    • Initial capture using affinity chromatography with His-tag (if the recombinant protein contains this tag)

    • Secondary purification using size exclusion chromatography to remove aggregates

  • Storage conditions: Store purified FAM151A at -20°C in Tris-based buffer with 50% glycerol. For extended storage, -80°C is recommended. Avoid repeated freeze-thaw cycles and store working aliquots at 4°C for up to one week .

How can researchers validate FAM151A antibodies for experimental use?

Antibody validation is crucial for reliable experimental results. For FAM151A research, consider these validation steps:

  • Western blot validation: Test antibodies against recombinant FAM151A protein to confirm specificity and appropriate molecular weight detection (~95 kDa) .

  • Immunohistochemistry controls: Include kidney tissue samples as positive controls (where FAM151A is known to be expressed) and tissues like muscle as negative controls .

  • Knockout/knockdown validation: Where possible, validate antibody specificity using FAM151A knockout or knockdown models.

  • Cross-reactivity testing: If studying Pongo abelii FAM151A, test for cross-reactivity with human FAM151A due to high sequence homology between these species.

The recommended approach is to use multiple antibodies targeting different epitopes to confirm findings and reduce the risk of non-specific binding confounding results.

What methodologies are effective for studying the potential enzymatic activity of FAM151A?

Given that FAM151A's DUF2181 domains belong to the GDPD/PLCD superfamily known to hydrolyze glycerophosphodiester bonds , these approaches are recommended:

  • In vitro enzymatic assays: Design assays using recombinant FAM151A protein and fluorescently labeled glycerophosphodiester substrates. Monitor substrate cleavage spectrophotometrically.

  • Site-directed mutagenesis: Generate mutants targeting conserved residues in the first DUF2181 domain (predicted to be functional) and test for changes in enzymatic activity.

  • Metabolomic analysis: Compare glycerophospholipid profiles in kidney cells with normal versus altered FAM151A expression to identify potential in vivo substrates.

  • Lipidomic analysis: Particularly in kidney tubule cells, analyze changes in membrane lipid composition when FAM151A is overexpressed or knocked down.

When designing these experiments, it's important to note that the second DUF2181 domain is predicted to be nonfunctional based on homology analysis , so comparing the activities of both domains could provide insight into the structural requirements for enzymatic function.

How can researchers investigate the role of FAM151A in kidney tubule function?

To study FAM151A's role in kidney tubules where it is specifically expressed , consider these methodological approaches:

  • Cell-specific knockdown: Use siRNA or CRISPR-Cas9 in primary kidney tubule cell cultures or kidney organoids to study the effects of FAM151A depletion.

  • Kidney-specific transgenic models: Generate conditional knockout mice with tubule-specific deletion of FAM151A to assess effects on renal physiology.

  • Ex vivo tubule perfusion: Perfuse isolated kidney tubules from control and FAM151A-knockout models to assess differences in transport function.

  • Proteomic interaction studies: Perform co-immunoprecipitation followed by mass spectrometry to identify FAM151A-interacting proteins in kidney tubule cells.

  • Functional transport assays: Measure ion transport, pH regulation, or solute handling in models with altered FAM151A expression to determine its impact on tubular function.

These approaches should be complemented with careful phenotypic characterization, including histological analysis, blood and urine biochemistry, and response to physiological challenges.

What is the relationship between FAM151A and its paralog FAM151B, and how should researchers approach studying this relationship?

FAM151A and FAM151B are paralogs with distinct structural differences—FAM151B contains only the first DUF2181 domain and lacks the transmembrane region present in FAM151A . To investigate their relationship:

  • Comparative expression analysis: Quantify expression patterns of both genes across tissues using qRT-PCR, RNA-seq, or spatial transcriptomics to identify regions of overlapping or distinct expression.

  • Double knockout studies: Generate single and double knockout models of FAM151A and FAM151B to assess additive, synergistic, or compensatory effects.

  • Phenotypic comparison: Compare phenotypes of FAM151A and FAM151B deficiency models. Research by Dr. Amy Findlay has shown that Fam151b is essential for retinal function, while Fam151a did not show a similar phenotype .

  • Domain-swapping experiments: Create chimeric proteins swapping domains between FAM151A and FAM151B to determine which domains confer specific functions.

  • Co-expression studies: Assess whether the proteins interact or influence each other's localization or function when co-expressed.

When designing these studies, researchers should note that despite both being homologs of the C. elegans menorin gene involved in dendrite branching , their distinct domain structures suggest potentially divergent functions in mammals.

What experimental approaches can be used to investigate FAM151A's potential role in colorectal cancer?

FAM151A contains an SNP, rs11206394, that is a significant predictor of colorectal cancer . To investigate this association:

  • Genotype-phenotype correlation studies: Analyze FAM151A expression levels in colorectal tissue samples stratified by rs11206394 genotype.

  • Cell proliferation and migration assays: Compare these cancer-related phenotypes in colorectal cancer cell lines with FAM151A overexpression, knockdown, or specific SNP variants.

  • Pathway analysis: Use phospho-proteomics to identify signaling pathways affected by FAM151A expression changes in colorectal cancer cell lines.

  • Mouse models: Generate transgenic mice harboring the human rs11206394 risk allele and assess susceptibility to chemically-induced or genetic models of colorectal cancer.

  • Clinical correlation studies: Analyze FAM151A expression and mutation status in patient-derived colorectal cancer samples relative to clinical outcomes and treatment responses.

These approaches should be integrated with mechanistic studies to determine whether FAM151A's enzymatic activity, protein interactions, or other functions contribute to colorectal cancer risk.

How can researchers study FAM151A's potential role in β-cell function and metabolism?

Recent research has identified FAM151A as a candidate regulator of genetic pathways associated with β-cell function in obesity . To investigate this:

  • Subpopulation analysis: Use single-cell RNA-seq to determine if the differential expression of FAM151A seen in bulk analysis is recapitulated at the single cell level across β-cell subpopulations .

  • Functional metabolic assays: In FAM151A-modulated β-cell lines or islets, measure:

    • Glucose-stimulated insulin secretion

    • Calcium signaling

    • Mitochondrial function

    • ER stress responses

  • Network analysis: Use weighted gene co-expression network analysis (WGCNA) to identify gene modules correlating with FAM151A expression and metabolic phenotypes, as demonstrated in previous research .

  • Diet-induced obesity models: Analyze FAM151A expression and β-cell function in animal models of diet-induced obesity with varying degrees of glucose tolerance.

  • Ex vivo islet studies: Isolate pancreatic islets from models with altered FAM151A expression and assess their response to metabolic challenges.

β-cell SubpopulationFAM151A Expression LevelAssociated Metabolic State
Subpopulation 1HighNormoglycemic-lean
Subpopulation 2ModerateNormoglycemic-obese
Subpopulation 3VariableHyperglycemic-obese
Subpopulation 4LowHyperglycemic-obese

Note: This table represents a hypothetical organization of data based on research approaches mentioned in reference . Researchers should generate actual data through single-cell RNA-seq experiments.

What controls and validation steps are essential when studying recombinant Pongo abelii FAM151A?

When working with recombinant Pongo abelii FAM151A:

  • Sequence verification: Confirm the expression construct through DNA sequencing against the reference sequence (Uniprot: Q5RDY9) .

  • Protein integrity validation:

    • SDS-PAGE to confirm molecular weight (~95 kDa)

    • Western blot with anti-FAM151A antibodies

    • Mass spectrometry to verify protein identity and potential post-translational modifications

  • Functional validation:

    • If studying enzymatic activity, include positive controls with known GDPD/PLCD superfamily members

    • Include both wild-type and catalytically inactive mutants

  • Species-specific considerations:

    • When extrapolating findings to human FAM151A, perform parallel experiments with human FAM151A or conduct comparative analyses

    • Document amino acid differences between Pongo abelii and human FAM151A that might affect function

  • Storage stability testing: Validate protein activity retention after various storage conditions to ensure experimental consistency.

How should researchers approach studying potential interactions between FAM151A and other proteins?

To investigate protein-protein interactions involving FAM151A:

  • In silico prediction:

    • Use structural prediction tools to identify potential interaction domains

    • Search for proteins containing complementary binding motifs

  • Yeast two-hybrid screening:

    • Use transmembrane yeast two-hybrid systems designed for membrane proteins

    • Consider using truncated versions lacking the transmembrane domain for conventional Y2H

  • Co-immunoprecipitation:

    • Use mild detergents to solubilize membrane-bound FAM151A

    • Perform reciprocal co-IPs with putative interacting partners

    • Consider proximity-dependent biotinylation (BioID) for capturing transient interactions

  • FRET/BRET assays:

    • Generate fluorescent protein fusions for live-cell interaction studies

    • Validate interactions with appropriately designed negative controls

  • Functional validation:

    • Demonstrate that identified interactions occur in physiologically relevant contexts

    • Perform domain mapping to identify specific interaction regions

When designing these experiments, consider that FAM151A's transmembrane domain may limit the applicability of some conventional interaction screening methods, and adaptation of techniques for membrane proteins will be necessary.

What are promising areas for future research on FAM151A function?

Based on current knowledge, these research directions hold significant promise:

  • Structural biology approaches:

    • Determine the crystal or cryo-EM structure of FAM151A, particularly focusing on the DUF2181 domains

    • Use structural insights to predict catalytic mechanisms and substrate specificity

  • Comprehensive functional characterization:

    • Develop FAM151A knockout models across multiple species to identify conserved functions

    • Perform unbiased metabolomic screens to identify potential physiological substrates

  • Tissue-specific roles:

    • Investigate kidney-specific functions, particularly in ion transport or membrane remodeling

    • Explore the emerging role in β-cell function and potential connections to metabolic disease

  • Clinical correlations:

    • Expand studies on the rs11206394 SNP and colorectal cancer risk

    • Screen for additional disease-associated variants in human populations

  • Evolutionary studies:

    • Investigate why FAM151A is absent in birds despite conservation in other vertebrates

    • Compare functions of FAM151A between humans and other primates like Pongo abelii

These directions should leverage emerging technologies like CRISPR-Cas9 gene editing, spatial transcriptomics, and advanced structural biology techniques to comprehensively characterize this understudied protein.

What methodological innovations could advance the study of FAM151A?

Emerging technologies that could significantly advance FAM151A research include:

  • Organoid models:

    • Kidney organoids to study tubular function

    • Pancreatic islet organoids to investigate β-cell roles

  • Single-cell multi-omics:

    • Integrated single-cell transcriptomics, proteomics, and metabolomics to map FAM151A's involvement in cellular pathways

    • Spatial transcriptomics to map expression patterns with cellular resolution

  • CRISPR screening approaches:

    • Genome-wide CRISPR screens in relevant cell types to identify genetic interactions with FAM151A

    • Base editing to introduce specific mutations for functional studies

  • In situ structural biology:

    • Cryo-electron tomography to visualize FAM151A in its native membrane environment

    • Integration with functional imaging (e.g., calcium imaging in β-cells)

  • Systems biology modeling:

    • Pathway modeling to integrate FAM151A into known signaling networks

    • Mathematical modeling of potential enzymatic functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.