Recombinant Pongo abelii Protein FAM162A (FAM162A)

Shipped with Ice Packs
In Stock

Description

Biological Function and Research Significance

FAM162A is a mitochondrial protein implicated in apoptosis, mitochondrial dynamics, and bioenergetics. Key findings from recent studies include:

Role in Mitochondrial Dynamics

FAM162A localizes to the inner mitochondrial membrane (IMM), particularly within cristae, where it interacts with OPA1 to regulate mitochondrial fusion . Loss of FAM162A disrupts cristae structure, leading to:

  • Reduced mitochondrial membrane potential (50% decrease) .

  • Increased punctate mitochondria (34% vs. 21% in controls) .

  • Impaired ATP production (45% reduction in spare capacity respiration) .

Apoptosis Regulation

FAM162A mediates hypoxia-induced apoptosis by:

  • Promoting cytochrome C release and caspase-9/3 activation .

  • Facilitating AIFM1 translocation to the nucleus in neuronal cells .

  • Modulating mitochondrial permeability transition pore (mPTP) opening via VDAC interaction .

Cancer and Stress Resistance

Paradoxically, FAM162A overexpression in cancers (e.g., cervical, gastric) correlates with enhanced proliferation under hypoxia . In Drosophila models, human FAM162A overexpression extends lifespan by 25% under normal conditions and 40% under heat stress .

Experimental Models

  • Cellular Studies: COS7 cells transfected with FAM162A variants (e.g., FAM-N-GFP, FAM-C-GFP) for protease protection assays to confirm IMM localization .

  • Organismal Models: Transgenic Drosophila overexpressing human FAM162A to assess longevity and stress resistance .

Technical Tools

Reagent TypeApplicationSource
Recombinant FAM162AMitochondrial dynamics assays, apoptosis studies
ELISA KitsQuantification of FAM162A expression levels
shRNA ConstructsKnockdown experiments to study loss-of-function

Comparative Analysis with Other Species

FAM162A shows high conservation across taxa, with recombinant proteins available for multiple species:

SpeciesExpression SystemTagKey Features
Pongo abeliiE. coliHisFull-length (1–154 aa), mitochondrial targeting
Homo sapiensE. coli/MammalianHis/GSTPartial/full-length variants for functional studies
Mus musculusE. coliHisFull-length (1–155 aa) for rodent model studies

Research Challenges and Future Directions

  • Topological Ambiguity: Conflicting predictions about transmembrane domains (2 vs. 1) require further structural validation.

  • Dual Roles in Apoptosis vs. Survival: Mechanisms underlying FAM162A’s pro-apoptotic vs. pro-survival functions in cancer require elucidation .

  • Therapeutic Potential: Exploring FAM162A as a target for mitochondrial diseases or cancer therapies .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FAM162A; E2IG5; Protein FAM162A; E2-induced gene 5 protein homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MGSLSGLRLAAGSCFRLCERDVFSSLRLTRSSDLKRINGFCTKPQESPRAPSRTYNRVPL HKPTEWQKKILVWSGRFKKEDEIPETVSLEMLDTAKNKMRVKISYLMIALTVVGCICMVI EGKKAAQRHESLTSLNLEKKARLREEAAMKAKTE
Uniprot No.

Target Background

Function

FAM162A is proposed to regulate apoptosis, although the precise mechanism may vary across cell types and tissues. It may be involved in hypoxia-induced cell death in transformed cells, potentially through cytochrome C release, caspase activation (e.g., CASP9), and induction of mitochondrial permeability transition. In neuronal cells, it may contribute to hypoxia-induced cell death by facilitating the release of AIFM1 from mitochondria to the cytoplasm and its subsequent nuclear translocation. However, the involvement of caspases in this process remains inconsistently reported.

Database Links
Protein Families
UPF0389 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is FAM162A and what is its cellular localization?

FAM162A (Family with sequence similarity 162 member A, also known as E2IG5, HGTD-P, and C3orf28) is a mitochondrial protein highly conserved across evolutionary taxa. Localization studies using protease protection assays in COS7 cells have definitively shown that FAM162A resides predominantly in the inner mitochondrial membrane (IMM), particularly within the cristae . This localization is significant as it contradicts earlier bioinformatic predictions suggesting outer mitochondrial membrane placement.

For researchers investigating FAM162A localization, fluorescence protease protection assays using constructs with GFP tags at either N-terminus (FAM-N-GFP) or C-terminus (FAM-C-GFP) provide reliable results. Control experiments should include co-transfection with markers for both intermembrane space (Omp25_mCherry) and mitochondrial matrix (pmMitoTurquoise) .

What experimental methods are most effective for studying FAM162A expression?

Several experimental approaches have proven effective for FAM162A research:

TechniqueApplicationRecommended ParametersNotes
Western BlotProtein expressionDilution 1:5000-1:50000Use anti-FAM162A antibodies specific to 17 kDa protein
ImmunofluorescenceCellular localizationDilution 1:200-1:800Validated in A431 cells
qRT-PCRmRNA expressionStandard protocolsTissue expression varies with highest in colon, esophagus, heart, kidney, and liver
Seahorse AnalysisBioenergetic functionMeasure OCR parametersAssess basal respiration, maximal respiration, spare capacity

When working with recombinant FAM162A protein, appropriate storage conditions (−20°C, avoid repeated freeze-thaw cycles) are critical for maintaining protein integrity. For extended storage, conservation at −20°C or −80°C is recommended .

How does FAM162A contribute to mitochondrial structure and dynamics?

FAM162A plays a crucial role in maintaining mitochondrial ultrastructure and promoting fusion dynamics. Loss-of-function experiments in COS7 cells demonstrate that FAM162A knockdown results in:

  • Significant shift in mitochondrial morphology: Increase in punctate mitochondria (from 21% to 34%) and decrease in networked mitochondria (from 26% to 9%)

  • Altered mitochondrial ultrastructure: FAM162A-silenced cells show smaller mitochondria with increased circularity and contain abnormal "bubble-like" swollen mitochondria with outer membrane disruption

  • OPA1 regulation: FAM162A knockdown causes approximately 50% reduction in OPA1 levels without affecting other fusion (MFN1, MFN2) or fission (DRP1, phosphorylated DRP1, FIS1) proteins

To investigate these structural changes, researchers should employ both confocal microscopy with mitochondrial stains (e.g., TMRE) and transmission electron microscopy. Quantitative analysis should classify mitochondrial units into morphological categories (puncta, large/round, rod, network) and measure parameters including area, perimeter, and circularity .

What methodological approaches can resolve the paradox between FAM162A's pro-apoptotic function and its overexpression in cancer?

This apparent contradiction presents a fascinating research challenge. FAM162A was initially identified as a pro-apoptotic protein involved in hypoxia-induced cell death, yet it is paradoxically overexpressed in several cancer types where it appears to promote proliferation rather than apoptosis .

To investigate this dual functionality, researchers should consider:

  • Bioenergetic profiling: Measure oxygen consumption rates (OCR) using Seahorse technology to determine how FAM162A affects basal respiration, maximal respiration, and spare respiratory capacity in normal versus cancer cells

  • Cell viability assays: Compare the effects of FAM162A manipulation (knockdown/overexpression) on cell viability (MTT assay) and mortality (LDH assay) in normal and cancer cell lines

  • Stress response experiments: Expose cells to various stressors (hypoxia, oxidative stress, nutrient deprivation) and measure how FAM162A affects survival outcomes

  • Mitochondrial turnover assessment: Use fluorescent reporters like MitoTimer to track mitochondrial turnover rates in different contexts

Recent experiments show that FAM162A knockdown reduces cell viability by approximately 30% and increases mortality by 30% in normal cells, suggesting it plays a pro-survival role under normal conditions that may be exploited in cancer .

How does FAM162A influence mitochondrial bioenergetics and what methods are optimal for measuring these effects?

FAM162A significantly impacts mitochondrial bioenergetics. When examining FAM162A-silenced cells:

  • Mitochondrial membrane potential decreases by approximately 50% as measured by TMRE staining

  • Respiratory parameters show significant impairment:

    • 20% reduction in basal respiration

    • 30% reduction in maximal respiration

    • 45% reduction in spare respiratory capacity

For comprehensive bioenergetic assessment, researchers should:

  • Use Seahorse XF Analyzer to measure oxygen consumption rate (OCR) under various conditions (basal, following oligomycin, FCCP, and rotenone/antimycin A addition)

  • Combine with TMRE staining in non-quenching mode to assess membrane potential

  • Analyze OXPHOS protein expression via immunoblotting

  • Consider mitophagy and mitochondrial turnover rates using MitoTimer or similar fluorescent reporters

Interestingly, the respiratory deficits observed in FAM162A-deficient cells occur despite normal expression levels of OXPHOS proteins, suggesting functional rather than expression-level regulation .

What insights have transgenic Drosophila models provided about FAM162A's physiological roles?

Transgenic Drosophila overexpressing human FAM162A (hFAM162A_OE) have revealed significant physiological effects:

  • Extended lifespan: 25% increase in survival compared to control flies (both Control-Gal4 and Control UAS_FAM162A) at 29°C

  • Sex-specific effects: Female flies showed approximately 12.5% greater extension in lifespan than males

  • Enhanced stress resistance: Under heat stress conditions (40°C), hFAM162A_OE flies demonstrated significantly improved survival

To generate similar models, researchers should:

  • Clone human FAM162A cDNA (optimized for Drosophila codon usage) into the pUASTattB-5xUAS/Mini_Hsp70 vector

  • Use the UAS/GAL4 system for targeted expression (e.g., Tubulin-GAL4 for ubiquitous expression)

  • For lifespan studies, house 20 flies per condition at 29°C with daily monitoring

  • For stress tests, subject flies to 40°C and record survival and locomotor activity

  • Normalize velocity parameters by fly weight

  • Apply Kaplan-Meier analysis for survival curves

This in vivo model provides compelling evidence that FAM162A functions as a pro-survival factor at the organismal level.

What techniques can be used to investigate FAM162A's topology in the inner mitochondrial membrane?

Determining the precise topology of FAM162A has been challenging, with conflicting predictions in the literature. To resolve this question:

  • Protease protection assays: Generate constructs with fluorescent tags (e.g., GFP) at either N-terminus or C-terminus and assess protease sensitivity

  • Structural modeling: Use AlphaFold 2.0 or similar AI-based modeling software to predict protein structure. Current models suggest FAM162A contains two transmembrane segments, an extended loop with a short alpha-helix domain, and a C-terminus alpha-helix structure

  • Site-directed mutagenesis: Create targeted mutations in potential membrane-spanning regions to assess their importance for localization and function

  • Super-resolution microscopy: Employ techniques like STORM or PALM with specific markers for different mitochondrial compartments to precisely localize FAM162A

  • Immuno-EM: Use gold-labeled antibodies against FAM162A for electron microscopy visualization of the exact cristae localization

These approaches collectively provide a comprehensive view of FAM162A's topology, which appears to differ from earlier bioinformatic predictions suggesting a single transmembrane segment in the outer mitochondrial membrane .

How does FAM162A influence mitochondrial quality control and stress responses?

FAM162A significantly impacts mitochondrial quality control mechanisms and stress responses:

  • Mitochondrial turnover: Experiments with the fluorescent MitoTimer reporter showed that FAM162A overexpression enhances mitochondrial turnover rates under both basal and stressed conditions. After paraquat (oxidative stress) treatment, FAM162A-overexpressing cells maintained a significantly higher proportion of newly synthesized mitochondria compared to controls

  • Oxidative stress resistance: FAM162A appears to protect against oxidative stress-induced damage, as evidenced by both cellular experiments and transgenic Drosophila models

To investigate these aspects, researchers should:

  • Use reporters like MitoTimer that change fluorescence properties with age (green→red shift indicates aging mitochondria)

  • Apply stress inducers like paraquat (100μM) to assess mitochondrial response

  • Quantify the ratio of new (green) to old (red) mitochondria under various conditions

  • Correlate mitochondrial turnover with other parameters such as membrane potential and respiratory capacity

These methodologies can help elucidate FAM162A's role in maintaining mitochondrial health under stress conditions.

What methods are recommended for investigating the interaction between FAM162A and OPA1?

The significant reduction in OPA1 levels following FAM162A knockdown suggests an important functional relationship between these proteins . To explore this interaction:

  • Co-immunoprecipitation: Use antibodies against FAM162A to pull down protein complexes and probe for OPA1, or vice versa

  • Proximity ligation assay (PLA): Detect potential direct interaction between the two proteins in situ

  • Super-resolution microscopy: Visualize co-localization at nanometer-scale resolution

  • Rescue experiments: Test whether OPA1 overexpression can rescue phenotypes caused by FAM162A knockdown

  • Domain mapping: Create truncated or mutated versions of both proteins to identify interaction domains

This relationship is particularly significant as OPA1 is a key regulator of cristae morphology and mitochondrial fusion. Understanding how FAM162A regulates OPA1 could provide insights into the mechanisms underlying FAM162A's effects on mitochondrial structure and dynamics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.