Recombinant Pongo abelii Protein MAL2 (MAL2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MAL2; Protein MAL2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
MAL2
Target Protein Sequence
MSAGGASVPPPPNPAVSFPVPRVTLPAGPDILRTYSGAFVCLEILFGGLVWILVASSNVP LPLLQGWVMFVSVTAFFFSLLFLGLFLSGMVTQIDANWNFLDFAYHFTVFVFYFGAFLLE AAATSLHDLHYNITMTGQPLLNDNQYNINVAASIFAFMTTACYGCSLGLALRRWRP
Uniprot No.

Target Background

Function
This protein is a component of the polarized transport machinery. It plays a crucial role in the indirect transcytotic route, specifically in the egress of transcytosing cargo from perinuclear endosomes. This allows the cargo to travel to the apical surface via a raft-dependent pathway.
Database Links
Protein Families
MAL family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for Recombinant Pongo abelii MAL2 protein?

For optimal stability and functionality, Recombinant Pongo abelii MAL2 protein should be stored according to the following protocol:

  • Upon receipt, store the lyophilized protein at -20°C/-80°C

  • After reconstitution, store working aliquots at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being the recommended default)

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles, which can significantly degrade protein quality

  • Store these aliquots at -20°C/-80°C

The protein is supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during storage .

How should I reconstitute lyophilized Recombinant Pongo abelii MAL2 protein for experimental use?

The recommended reconstitution protocol includes these methodological steps:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration between 5-50% (recommended: 50%)

  • Aliquot the reconstituted protein immediately to prevent protein degradation from repeated freeze-thaw cycles

  • Store aliquots as directed in the storage protocol

This approach maximizes protein stability while ensuring consistent experimental results across multiple studies.

What are the key differences between MAL2 proteins from different species?

When comparing MAL2 proteins across species, several important research considerations emerge:

SpeciesUniProt IDAvailable FormsTagged VersionExpression SystemKey Research Applications
Pongo abelii (Orangutan)Q5RAI2Full Length (1-176aa)His-TaggedE. coliComparative evolutionary studies
HumanVariousFull LengthGST-taggedVariousFunctional studies, biomarker research
MouseVariousFull LengthHis-TaggedVariousAnimal model studies
ChickenNot specifiedNot specifiedNot specifiedNot specifiedComparative vertebrate studies

This cross-species comparison facilitates evolutionary studies and functional conservation analyses across different taxonomic groups .

What mass spectrometry approaches are most effective for identifying and characterizing Pongo abelii MAL2 protein in paleoproteomics research?

For optimal characterization of MAL2 in paleoproteomics research, two complementary mass spectrometry approaches are recommended:

  • MALDI-TOF with Peptide Mass Fingerprinting (PMF): This approach generates a spectrum of mass-to-charge ratio (m/z) versus intensity, with peaks that can be analyzed using protein databases. While useful for initial screening, PMF may have limitations for ancient or degraded samples where modifications have occurred .

  • LC-MS/MS with Shotgun Proteomics: This more powerful approach uses collision-induced dissociation (CID) to generate fragment ions (primarily b- and y-ions). The resulting MS2 spectra provide higher confidence peptide identification through sequence determination rather than relying solely on precursor ion m/z. For ancient or modified proteins like those found in paleoproteomics research, LC-MS/MS offers superior identification capabilities .

When analyzing Pongo abelii MAL2, researchers should be aware of potential challenges including:

  • Low abundance peptides may be underrepresented in DDA (Data-Dependent Acquisition) methods

  • Mixed MS2 spectra from DIA (Data-Independent Acquisition) can be difficult to deconvolute

  • Targeted methods like MRM (Multiple Reaction Monitoring) or PRM (Parallel Reaction Monitoring) may miss unknown modifications

How can researchers overcome protein identification challenges when working with Pongo abelii MAL2 in comparative studies with less-characterized species?

When conducting comparative studies involving Pongo abelii MAL2 and proteins from less-characterized species, researchers face several database-related challenges. To overcome these limitations:

  • Database Expansion Strategy: Supplement established databases (UniProtKB, NCBI GenBank) with sequences from closely related species. For example, while Bos taurus has 140,740 entries in UniProtKB, related species like Bos javanicus have fewer than 400 protein sequences available .

  • Manual Sequence Validation: Always manually check sequence alignments and verify taxonomic specificity of matches to avoid misidentification due to database artifacts. This is particularly important when comparing MAL2 across primate species where sequence coverage may vary significantly .

  • De Novo Sequencing Approach: Implement de novo sequencing to identify peptides not present in databases. This becomes particularly important for evolutionary studies of MAL2 across different primate species where database representation is uneven .

  • Database Representation Awareness: Consider the disparity in database representation when interpreting results. For example, common research species have vastly more protein entries than related but less-studied species, which can bias comparative analyses .

What are the optimal experimental protocols for studying MAL2 protein-protein interactions in Pongo abelii samples?

For investigating MAL2 protein-protein interactions in Pongo abelii samples, a comprehensive experimental protocol should include:

What analytical considerations are critical when comparing recombinant Pongo abelii MAL2 with the native protein?

When comparing recombinant and native MAL2 proteins from Pongo abelii, researchers should address these critical analytical considerations:

  • Post-translational Modification (PTM) Analysis: Recombinant proteins expressed in E. coli lack many eukaryotic PTMs present in native proteins. Comprehensive analysis should include:

    • Phosphorylation site mapping

    • Glycosylation profiling

    • Acetylation assessment

    • Other potential modifications that may affect function

  • Structural Validation: Confirm proper protein folding using:

    • Circular dichroism (CD) spectroscopy

    • Differential scanning fluorimetry (DSF)

    • Limited proteolysis to assess structural integrity

  • Functional Assays: Conduct comparative functional assays to evaluate whether the recombinant protein retains native activity:

    • Binding assays with known interaction partners

    • Enzymatic activity measurements if applicable

    • Cellular localization studies using fluorescently tagged variants

  • Tag Interference Assessment: Evaluate whether the His-tag affects protein structure or function:

    • Compare tagged versus cleaved versions if possible

    • Perform binding assays with and without the tag

    • Consider alternative tagging strategies if interference is detected

How can Recombinant Pongo abelii MAL2 protein be utilized in evolutionary studies of primates?

Recombinant Pongo abelii MAL2 provides a valuable tool for evolutionary studies across primate lineages through several methodological approaches:

  • Sequence Homology Analysis: Compare the 176-amino acid sequence of Pongo abelii MAL2 with corresponding proteins from other primates to identify conserved regions and species-specific variations. This can elucidate evolutionary pressures on different protein domains .

  • Functional Conservation Testing: Use the recombinant protein in comparative functional assays to determine whether MAL2's molecular function is conserved across primate species, particularly between great apes and humans.

  • Structural Comparison Studies: Leverage the full-length recombinant protein to generate structural models that can be compared across species, revealing evolutionary changes in protein folding and interaction interfaces.

  • Paleoproteomics Integration: Combine recombinant protein analysis with paleoproteomics techniques to compare modern MAL2 with ancient protein fragments recovered from fossil samples, providing direct evidence of protein evolution over time .

  • Cross-Species Interaction Analysis: Test whether interaction partners of MAL2 are conserved between Pongo abelii and other primates by conducting comparative binding assays using the recombinant protein.

What are the challenges and solutions in using mass spectrometry to identify post-translational modifications in recombinant Pongo abelii MAL2?

Identifying post-translational modifications (PTMs) in recombinant Pongo abelii MAL2 using mass spectrometry presents several challenges:

ChallengeDescriptionMethodological Solution
Limited PTMs in E. coliE. coli expression systems lack machinery for many eukaryotic PTMsUse eukaryotic expression systems (insect cells, mammalian cells) for PTM studies
Low abundance of modified peptidesModified peptides often present at substoichiometric levelsEmploy enrichment techniques (e.g., IMAC for phosphopeptides, lectin affinity for glycopeptides)
Ionization suppressionModified peptides may ionize poorlyUse alternative fragmentation methods (ETD/ECD) that preserve labile modifications
Database limitationsPTM search space increases computational demands exponentiallyImplement targeted PTM searches based on predicted modification sites
Artifactual modificationsSample processing can introduce non-biological modificationsInclude appropriate controls and use preservation methods that minimize artifactual changes
Data analysis complexityPTM identification requires sophisticated algorithmsApply specialized software (PTM-finder, Byonic) and manual validation of spectral matches

For comprehensive PTM analysis, researchers should consider combining traditional bottom-up proteomics with top-down approaches that preserve intact protein forms and their modification patterns.

How does protein diagenesis affect the detection and analysis of MAL2 in ancient samples?

Protein diagenesis significantly impacts the detection and analysis of MAL2 in ancient samples through several mechanisms:

  • Backbone Cleavage: Diagenetic processes cause peptide backbone cleavage over time, altering the expected peptide profile and potentially eliminating diagnostic peptides used for MAL2 identification. This requires adaptive search strategies that account for fragmentation patterns typical in ancient samples .

  • Amino Acid Modifications: Common diagenetic modifications include deamidation of asparagine and glutamine, oxidation of methionine, and conversion of lysine to allysine. These modifications shift mass values and can confound standard database searches if not explicitly included in modification parameters .

  • Crosslinking Effects: Formation of crosslinks between MAL2 and other biomolecules (including other proteins, mineral phases, or humic substances) can make extraction and analysis challenging. Specialized extraction protocols incorporating surfactants and denaturants may be necessary .

  • Sample Reproducibility Challenges: Unlike paleogenomics, ancient protein studies have yet to achieve high reproducibility due to stochastic degradation processes. This necessitates multiple technical replicates and careful validation of results .

  • Database Challenges: For ancient samples, researchers must often expand search spaces to include extinct species and evolutionary variants not represented in modern databases, significantly increasing computational demands .

What are the common pitfalls in SDS-PAGE analysis of Recombinant Pongo abelii MAL2 and how can they be avoided?

When performing SDS-PAGE analysis of Recombinant Pongo abelii MAL2, researchers commonly encounter several technical challenges that can be addressed with specific methodological approaches:

  • Protein Aggregation: His-tagged MAL2 may form aggregates that appear as higher molecular weight bands.

    • Solution: Include reducing agents (5-10 mM DTT or β-mercaptoethanol) in sample buffer

    • Heat samples at 95°C for 5 minutes before loading

    • Consider adding 8M urea to completely denature aggregates in problematic samples

  • Unexpected Mobility: The apparent molecular weight may differ from the calculated value (176 amino acids plus His-tag).

    • Solution: Use protein standards that span the expected range (15-25 kDa)

    • Consider native PAGE alongside SDS-PAGE to evaluate structural contributions to mobility

    • Account for the impact of the His-tag on mobility (~2-3 kDa addition)

  • Low Signal Intensity: MAL2 may stain poorly with certain dyes.

    • Solution: Use sensitive staining methods like silver stain or SYPRO Ruby

    • Increase protein loading to 1-5 μg for standard Coomassie detection

    • Consider western blotting with anti-His antibodies for enhanced sensitivity

  • Degradation Products: Multiple bands or smearing may indicate protein degradation.

    • Solution: Add protease inhibitors during all preparation steps

    • Process samples at 4°C throughout

    • Analyze samples immediately after reconstitution or add stabilizing agents

How can researchers validate the structural integrity of recombinant Pongo abelii MAL2 after reconstitution?

To ensure recombinant Pongo abelii MAL2 maintains its structural integrity after reconstitution, a multi-method validation approach is recommended:

  • Circular Dichroism (CD) Spectroscopy: CD provides information about secondary structure elements.

    • Far-UV CD (190-250 nm) reveals α-helical, β-sheet, and random coil content

    • Near-UV CD (250-350 nm) provides information about tertiary structure

    • Comparative analysis with known structural homologs can confirm proper folding

  • Size Exclusion Chromatography (SEC): SEC assesses aggregation state and oligomeric distribution.

    • Single, symmetric peak indicates homogeneous preparation

    • Multiple peaks may suggest aggregation, oligomerization, or degradation

    • Comparison of elution volumes before and after storage evaluates stability

  • Dynamic Light Scattering (DLS): DLS measures hydrodynamic radius and polydispersity.

    • Low polydispersity index (<0.2) indicates uniform particle size distribution

    • Monitoring over time can reveal aggregation tendencies

    • Temperature ramping identifies stability thresholds

  • Limited Proteolysis: Controlled proteolytic digestion probes structural accessibility.

    • Well-folded proteins show characteristic digestion patterns

    • Improperly folded proteins typically exhibit increased susceptibility to proteases

    • Time-course digestion provides insights into domain stability

  • Functional Assays: Activity-based assays confirm biological relevance.

    • Binding assays with known interaction partners

    • Activity assays if enzymatic functions are known

    • Comparison with native protein when available provides reference points

What strategies can optimize the expression and purification of Recombinant Pongo abelii MAL2 in E. coli systems?

For optimal expression and purification of Recombinant Pongo abelii MAL2 in E. coli systems, researchers should implement these evidence-based strategies:

  • Expression Optimization:

    • Strain Selection: BL21(DE3) derivatives like Rosetta or Arctic Express can improve expression of eukaryotic proteins

    • Temperature Modulation: Lower induction temperature (16-25°C) often increases soluble protein yield

    • Induction Parameters: Optimize IPTG concentration (0.1-1.0 mM) and induction duration (4-24 hours)

    • Media Formulation: Enriched media like Terrific Broth can significantly increase biomass and protein yield

  • Solubility Enhancement:

    • Fusion Tags: Consider alternative tags beyond His-tag (e.g., GST, MBP, SUMO) that can enhance solubility

    • Lysis Buffer Optimization: Include solubility enhancers like 0.1% Triton X-100, 5-10% glycerol, or 50-100 mM arginine

    • Co-expression: Molecular chaperones (GroEL/GroES, DnaK/DnaJ) can improve folding efficiency

  • Purification Refinement:

    • IMAC Conditions: Optimize imidazole concentration in binding (10-20 mM) and elution (250-500 mM) buffers

    • Secondary Purification: Implement ion exchange or size exclusion chromatography as polishing steps

    • On-column Refolding: For inclusion bodies, consider on-column refolding during purification

  • Quality Control Metrics:

    • Purity Assessment: Aim for >95% purity by SDS-PAGE for research applications

    • Endotoxin Removal: Add Triton X-114 phase separation if endotoxin contamination is a concern

    • Aggregation Monitoring: Use DLS or analytical SEC to confirm monodispersity

What are the emerging technologies that will advance Pongo abelii MAL2 protein research?

Emerging technologies that will significantly impact future Pongo abelii MAL2 research include:

  • AI-Driven Structural Prediction: Tools like AlphaFold are revolutionizing protein structure prediction, potentially allowing researchers to model MAL2 structural differences across species with unprecedented accuracy. This will enable better understanding of functional domains and evolutionary changes without requiring crystallization .

  • Single-Molecule Proteomics: Emerging nanopore-based technologies promise to analyze individual protein molecules, potentially revealing heterogeneity in MAL2 modifications and conformations that are masked in bulk analyses.

  • In Situ Mass Spectrometry Imaging: Advanced MSI techniques with improved spatial resolution will allow visualization of MAL2 distribution in tissues, providing contextual information about localization and interaction partners in native environments .

  • Long-Read Proteomics: New approaches that preserve longer protein fragments will improve characterization of MAL2 proteoforms, particularly important for understanding evolutionarily divergent regions.

  • Paleoproteomics Integration: Continual advances in paleoproteomics will enable better recovery and analysis of ancient MAL2 proteins, potentially from fossil specimens of extinct great ape lineages, providing direct evidence of protein evolution over time .

These technological advances promise to deepen our understanding of MAL2 structure, function, and evolution across primates, with particular relevance for comparative studies involving Pongo abelii.

How can integrative approaches combining proteomics and genomics enhance our understanding of Pongo abelii MAL2 function and evolution?

Integrative approaches combining proteomics and genomics offer powerful frameworks for advancing Pongo abelii MAL2 research:

  • Proteogenomic Mapping: Cross-reference proteomic data with genomic sequences to identify potential splice variants, novel MAL2 isoforms, and post-translational modifications specific to Pongo abelii. This approach can reveal regulatory mechanisms that may differ between orangutans and other primates.

  • Evolutionary Rate Analysis: Combine genomic sequence analysis with proteomic validation to determine whether MAL2 is under positive selection, purifying selection, or neutral evolution in the orangutan lineage compared to other great apes.

  • Structural Variation Impact: Correlate genomic structural variations with proteomic expression patterns to understand how copy number variations or regulatory element changes affect MAL2 expression and function in different orangutan populations.

  • Ancient DNA-Protein Correlation: For paleontological samples, integrate ancient DNA analysis with paleoproteomics to validate sequence reconstructions and identify post-mortem modifications versus true evolutionary changes in MAL2 .

  • Multi-omics Functional Profiling: Combine transcriptomics, proteomics, and interactomics to build comprehensive functional networks around MAL2, revealing its biological role and how it may have adapted during primate evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.