Recombinant Pongo abelii Protein odr-4 homolog (ODR4)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Pongo abelii Protein odr-4 homolog (ODR4) is a protein that is found in the Sumatran orangutan (Pongo abelii) . The protein is a homolog of the C. elegans ODR-4 protein, which is involved in the localization of G protein-coupled receptors (GPCRs) . ODR4 is expressed widely in mammals, suggesting a broader role in GPCR biogenesis .

  • Other Names: Protein odr-4 homolog

  • Gene Name: ODR4

  • Species: Pongo abelii (Sumatran orangutan)

  • UniProt No.: Q5R6E9

Function

  • GPCR Maturation: In C. elegans, ODR-4 interacts with ODR-8/Ufm1 Specific Protease 2 (UfSP2) to promote GPCR maturation . This complex promotes GPCR folding, maturation, or export from the ER .

  • Neuronal Function: ODR-4 functions in the AWA neurons to promote chemotaxis to the odor diacetyl and in the ADL neurons to promote aggregation .

Interactions

  • ODR-8/UfSP2: ODR-4 interacts physically with ODR-8/UfSP2 at the ER membrane . This interaction is important for GPCR biogenesis and is conserved from plants to humans .

  • ODR-10: ODR-4 also binds ODR-10, suggesting that an ODR-4/ODR-8 complex promotes GPCR folding, maturation, or export from the ER .

Expression

  • Co-expression: ODR-4 and ODR-8 are co-expressed in the same head and tail neurons in C. elegans . These include the amphid neurons ADL, ASI, ASH, ASJ, ASG, ADF, ASK, AWA, AWB, AWC, and the phasmid neurons PHA and PHB .

  • Mammals: ODR4 and UfSP2 are expressed widely in mammals, suggesting a broader role in GPCR biogenesis .

Research Findings

  • ER Complex: ODR-4 interacts biochemically with ODR-8 and ODR-10 to form an ER complex .

  • Ufm1-Independent Mechanism: An ER complex of ODR-4 and ODR-8/Ufm1 Specific Protease 2 Promotes GPCR Maturation by a Ufm1-Independent Mechanism .

  • Human Homolog: Human ODR4 can bind human UfSP2 and recruit it to ER membranes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ODR4; Protein odr-4 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-454
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
ODR4
Target Protein Sequence
MGRTYIVEETVGQYLSNIGLQGKAFVSGLLIGQCSSQKDYVILATRTPPKEEQSENLKHL KAKLDNLDEEWATEHACQVSRMLPGGLLVLGVFIITTLELANDFQNALRRLMFAVEKSIN RKRLWNFTEEEVSERVTLHICASTKKKIFCRTYDIHDPKSSARPADWKYQSGLSSSWLSL ECTVHINIHIPLSATSVSYTLEKNTKNGLTRWAKEIENGVYLINGQVKDEDCDLLEGQKK SRGNTQATSHSFDVRVLTQLLLNSDHRSTATVQICSGSVNLKGAVKCRAYIHSSKPKVKD AVQAVKRDILNTVADRCEILFEDLLLNEIPEKKDSEKEFHVLPYRVFVPLPGSTVMLCDY KFDDESAEEIRDHFMEMLDHTIKIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPI KTTMLLKIQQNIGVIAAFTVAVLAAGISFHYFSD
Uniprot No.

Target Background

Function
May play a role in the trafficking of a subset of G-protein coupled receptors.
Database Links
Protein Families
ODR-4 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Pongo abelii Protein odr-4 homolog (ODR4) and what is its molecular structure?

Recombinant Pongo abelii Protein odr-4 homolog (ODR4) is a protein derived from the Sumatran orangutan (Pongo abelii) with UniProt accession number Q5R6E9. The full-length protein consists of 454 amino acids and maintains a complex structure characterized by multiple transmembrane domains. The protein contains various functional regions including hydrophobic segments that facilitate membrane insertion and potential ligand-binding domains. The recombinant form is produced through expression systems that maintain the protein's native structural characteristics while allowing for controlled production for research applications .

What experimental approaches are most effective for studying ODR4 protein function?

When investigating ODR4 protein function, researchers should implement a multi-faceted experimental approach:

  • Gene knockout/knockdown studies: CRISPR-Cas9 or RNAi technologies can be employed to reduce or eliminate ODR4 expression, allowing observation of resulting phenotypic changes.

  • Protein-protein interaction assays: Co-immunoprecipitation, yeast two-hybrid screens, or proximity labeling techniques help identify binding partners that provide insights into functional pathways.

  • Subcellular localization studies: Fluorescent tagging combined with confocal microscopy reveals the protein's distribution within cells, indicating potential functional roles.

  • Domain mutation analysis: Systematic alteration of specific protein domains followed by functional assays can identify critical regions for activity.

  • Comparative analysis across species: Examining functional conservation between ODR4 homologs provides evolutionary context and functional insights.

When designing these experiments, it's crucial to maintain appropriate controls and consider potential artifacts introduced by recombinant expression systems or tags that might affect protein folding or localization .

How can experimental designs be optimized when studying ODR4 protein interactions?

Optimizing experimental designs for ODR4 protein interaction studies requires careful consideration of several methodological factors:

  • Pre-experimental validation: Confirm recombinant ODR4 integrity through Western blotting and activity assays before proceeding with interaction studies.

  • Control group selection: Implement both positive and negative controls in each experimental iteration. For ODR4 studies, this should include:

    • Known interacting partners as positive controls

    • Structurally similar but non-interacting proteins as negative controls

    • Empty vector controls when using expression systems

  • Randomization protocols: When testing multiple conditions, randomize sample processing and analysis to minimize systematic bias, following principles established in experimental design literature .

  • Crossover validation: Apply multiple interaction detection methods (e.g., in vitro pull-downs and in vivo co-localization) to confirm findings through independent methodological approaches.

  • Statistical power analysis: Predetermine sample sizes necessary for statistical significance based on expected effect sizes and variability.

This systematic approach enhances reproducibility and validity of protein interaction findings while minimizing false positives and negatives .

How can researchers address data contradictions when studying ODR4 function across different model systems?

When confronting contradictory data regarding ODR4 function across different experimental models, researchers should implement a structured approach to resolution:

  • Systematic comparison analysis: Create a comprehensive data comparison table that includes:

Model SystemExperimental ApproachODR4 Function ObservedPotential Confounding VariablesStatistical Significance
Cell Line AsiRNA knockdownMembrane traffickingExpression level variationsp < 0.01
Cell Line BCRISPR knockoutNo phenotype observedPotential compensatory mechanismsN/A
In vivo modelConditional knockoutDevelopmental defectsSystemic effectsp < 0.05
  • Meta-analytical approach: Determine whether contradictions represent true biological differences or methodological artifacts through statistical comparison of effect sizes across studies.

  • Mechanistic resolution experiments: Design targeted experiments that specifically address the contradictory findings, such as:

    • Rescue experiments in different models using identical ODR4 constructs

    • Direct comparison of protein interaction networks across systems

    • Time-course studies to identify temporal differences in protein function

  • Collaborative cross-validation: Establish collaborations with laboratories using different model systems to perform identical experiments under standardized conditions.

This systematic approach transforms contradictions from obstacles into opportunities for deeper mechanistic understanding of context-dependent protein function .

What are the most effective time-series experimental designs for studying ODR4 dynamics?

When investigating ODR4 dynamics, researchers should consider implementing time-series experimental designs that capture the temporal nature of protein activity:

  • Multiple time-series design: This approach involves taking measurements at regular intervals before and after experimental intervention (e.g., stimulation, inhibition) in both treatment and control groups. For ODR4 studies, this might involve:

    • Baseline measurements (pre-treatment)

    • Short-term response (minutes to hours)

    • Intermediate adaptation (hours to days)

    • Long-term effects (days to weeks)

  • Statistical considerations: Time-series data require specialized analytical approaches:

    • Repeated measures ANOVA for comparing treatment effects across time points

    • Mixed-effects models to account for individual variation within experimental units

    • Autocorrelation analysis to identify temporal patterns in protein activity

  • Control implementations: To strengthen internal validity, researchers should incorporate:

    • Parallel control series with identical measurement timing

    • Randomization of treatment assignment

    • Blinding of analysts to treatment conditions when possible

  • Technical considerations: When designing time-series experiments for ODR4:

    • Ensure protein stability throughout the experimental timeline

    • Control for circadian or cell-cycle effects that might confound observations

    • Consider using automated sampling systems for high-resolution temporal data

This approach allows for robust detection of causal relationships between experimental manipulations and ODR4 dynamic responses .

What are the optimal storage and handling conditions for recombinant Pongo abelii ODR4 protein?

Maintaining recombinant ODR4 stability requires precise storage and handling protocols:

  • Storage buffer composition: Store in Tris-based buffer with 50% glycerol optimized specifically for ODR4 stability. This buffer composition prevents protein aggregation and maintains structural integrity.

  • Temperature considerations:

    • Long-term storage: -20°C or -80°C (preferred for extended periods)

    • Working aliquots: 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

  • Aliquoting strategy: Upon receipt, divide the stock solution into single-use aliquots to minimize freeze-thaw damage.

  • Quality control timeline: Implement periodic quality checks throughout storage:

    • Activity assays at 0, 3, 6, and 12 months

    • SDS-PAGE analysis to detect degradation products

    • Functional verification before critical experiments

  • Documentation practices: Maintain detailed records of storage conditions, freeze-thaw cycles, and functional verification results to ensure experimental reproducibility .

How can researchers develop robust experimental controls when using recombinant ODR4 in functional assays?

Developing robust experimental controls for ODR4 functional assays requires a multi-layered approach:

  • Negative controls:

    • Heat-denatured ODR4 protein to control for non-specific effects

    • Buffer-only conditions to establish baseline measurements

    • Structurally similar but functionally distinct proteins to control for general protein effects

  • Positive controls:

    • Known functional assays with well-characterized outcomes

    • Established ODR4 interaction partners with validated detection methods

  • Technical validation controls:

    • Concentration-dependent response curves to ensure linearity of detection

    • Internal standards to normalize between experimental runs

    • Split-sample testing across different analytical platforms

  • Biological validation approaches:

    • Parallel testing in multiple cell types or model systems

    • Correlation of in vitro findings with in vivo phenotypes

    • Antibody validation using both positive and negative control samples

  • Statistical control measures:

    • Randomization of sample processing order

    • Blinded analysis where feasible

    • Technical replicates (same sample, multiple measurements) to assess precision

    • Biological replicates (different samples, same treatment) to assess reproducibility

These control strategies collectively enhance reliability and interpretability of functional data obtained with recombinant ODR4 .

What regression-discontinuity analytical approaches are appropriate for ODR4 expression data?

When analyzing ODR4 expression data that exhibits threshold effects or natural breakpoints, regression-discontinuity analysis offers powerful insights:

  • Analytical framework:

    • Identify the threshold variable (e.g., developmental stage, stress level, temperature)

    • Plot ODR4 expression against this continuous variable

    • Determine whether a discontinuity exists at specific threshold points

  • Statistical implementation:

    • Apply piecewise regression models that fit separate functions on either side of the threshold

    • Test the significance of the discontinuity coefficient

    • Conduct sensitivity analysis with varying bandwidth around the threshold

  • Validation approaches:

    • Perform placebo tests at non-threshold points to confirm specificity

    • Bootstrap confidence intervals to assess robustness

    • Compare with alternative modeling approaches (e.g., continuous non-linear models)

  • Application to ODR4 research questions:

    • Identifying critical thresholds in ODR4 expression during development

    • Determining dose-response relationships in experimental manipulations

    • Characterizing all-or-none regulatory mechanisms

When implementing this approach, researchers should be aware of potential confounding variables that may coincide with the threshold and conduct appropriate controls to establish causality versus correlation .

How can time-series data from ODR4 interaction studies be properly analyzed to control for autocorrelation?

Time-series data from ODR4 interaction studies often exhibit autocorrelation that can lead to invalid statistical inferences if not properly addressed:

  • Diagnostic approaches:

    • Calculate autocorrelation function (ACF) and partial autocorrelation function (PACF)

    • Perform Durbin-Watson tests to quantify first-order autocorrelation

    • Create lag plots to visualize temporal dependencies

  • Analytical methods for autocorrelated data:

    • ARIMA (Autoregressive Integrated Moving Average) models to account for temporal patterns

    • Generalized Least Squares (GLS) with autocorrelation structures

    • Newey-West standard errors for hypothesis testing with autocorrelated residuals

  • Experimental design considerations:

    • Increase sampling frequency to better characterize autocorrelation patterns

    • Include adequate run-in periods before experimental interventions

    • Implement multiple baseline measurements to establish pre-intervention trends

  • Interpretation guidelines:

    • Distinguish between statistical significance in original versus corrected analyses

    • Report both unadjusted and adjusted results for transparency

    • Consider biological plausibility of temporal patterns identified

What emerging research questions about ODR4 remain underexplored?

Several high-priority research directions regarding ODR4 remain underexplored despite their potential significance:

  • Evolutionary conservation analysis: Comparative studies across primate species could reveal critical functional domains and adaptive changes in ODR4 through evolutionary time.

  • Tissue-specific regulation: Systematic characterization of ODR4 expression patterns and regulatory mechanisms across different tissues remains incomplete.

  • Post-translational modification landscape: Comprehensive mapping of phosphorylation, glycosylation, and other modifications that may regulate ODR4 function is needed.

  • Structural biology approaches: High-resolution structural studies using cryo-EM or X-ray crystallography would provide critical insights into functional mechanisms.

  • Systems biology integration: Positioning ODR4 within broader cellular networks through multi-omics approaches would contextualize its molecular functions.

These research directions require interdisciplinary approaches and methodological innovation to address effectively .

What methodological frameworks optimize reproducibility in ODR4 research?

To enhance reproducibility in ODR4 research, investigators should implement a comprehensive methodological framework:

  • Protocol standardization: Develop and share detailed protocols for:

    • Protein production and purification

    • Storage and handling procedures

    • Functional assay implementations

    • Data processing workflows

  • Validation requirements:

    • Multiple antibody validation using genetic controls

    • Cross-platform verification of key findings

    • Independent replication in separate laboratories

  • Reporting standards:

    • Comprehensive methodology documentation following ARRIVE or similar guidelines

    • Full disclosure of negative and contradictory results

    • Sharing of raw data and analysis code through repositories

  • Experimental design enhancements:

    • A priori power analysis and sample size determination

    • Pre-registration of study protocols and analysis plans

    • Blinding procedures for subjective assessments

  • Quality control implementation:

    • Regular proficiency testing for key techniques

    • Standardized reference materials for calibration

    • Batch effect monitoring and correction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.