Recombinant Pongo abelii Protein SYS1 homolog (SYS1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SYS1; Protein SYS1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
SYS1
Target Protein Sequence
MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFST PPGRLSMMSFILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWW LVQAVCIALMAVIGEYLCMRTELKEIPLNSAPKSNV
Uniprot No.

Target Background

Function
This protein is involved in protein trafficking. It may act as a receptor for ARFRP1.
Database Links

KEGG: pon:100137180

UniGene: Pab.20111

Protein Families
SYS1 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Protein SYS1 homolog in Sumatran orangutan (Pongo abelii)?

Protein SYS1 homolog in Sumatran orangutan (Pongo abelii) is an integral membrane protein encoded by the SYS1 gene. It carries the protein identifier A4K2W1 and is primarily involved in protein trafficking within the cell. The protein is characterized as a Golgi trafficking protein that may serve as a receptor for ARFRP1 (ADP-ribosylation factor-related protein 1), though this functionality is noted by similarity rather than direct experimental validation in Pongo abelii specifically . The protein was first documented in the protein databases in 2017 and most recently updated in March 2025 . It is part of the broader SYS1 family of proteins that are conserved across different species and play important roles in cellular trafficking mechanisms.

SYS1 homolog's domain structure identifies it as an integral membrane protein linking to the trans-Golgi network, highlighting its subcellular localization and functional role . The genomic data for Pongo abelii, including the SYS1 gene, is available in genomic databases such as Ensembl under the genome assembly Susie_PABv2 (GCA_002880775.3) .

How does SYS1 function in cellular trafficking?

SYS1 in Pongo abelii functions primarily as a Golgi trafficking protein involved in the transport of cellular components between different compartments. The protein is believed to serve as a receptor for ARFRP1, which is critical for maintaining Golgi structure and function . This receptor function facilitates the recruitment of trafficking machinery to the Golgi apparatus, enabling the proper sorting and transport of proteins.

The trafficking function of SYS1 is integral to cellular homeostasis, as it helps maintain the integrity of the secretory pathway. By facilitating the movement of cargo between the Golgi and other cellular compartments, SYS1 contributes to processes such as protein secretion, membrane protein localization, and organelle biogenesis. Unlike β-catenin proteins like SYS-1 that function in transcriptional activation , SYS1 in Pongo abelii appears to be specialized for trafficking functions.

Researchers investigating SYS1's role in cellular trafficking should consider employing fluorescently tagged constructs similar to the approach used for visualizing related proteins such as SYS-1/β-catenin using VENUS yellow fluorescent protein tags . This methodology allows for real-time visualization of protein localization and trafficking dynamics within living cells.

What genomic resources are available for studying Pongo abelii SYS1?

Several genomic resources are available for researchers studying the SYS1 gene and protein in Pongo abelii. The Ensembl database provides comprehensive genomic information under the genome assembly Susie_PABv2 (GCA_002880775.3) . Through Ensembl, researchers can access:

  • Complete gene sequences and annotations

  • Protein-coding information and splice variants

  • Comparative genomics data including homologues and gene trees

  • Whole genome alignments across multiple species

Transcript data for SYS1 in Pongo abelii is available in nucleotide databases, with accession numbers XM_009233631.2 and XM_009233631.1 corresponding to transcript variant X1 . These resources provide valuable information about the gene structure, alternative splicing, and regulatory elements that may influence SYS1 expression.

Additionally, protein databases such as UniProt (A4K2W1) and PubChem contain annotation data about the SYS1 protein, including domain information, functional predictions, and sequence data . For researchers interested in ordering expression-ready ORF clones, commercial databases like GenScript provide access to cDNA clones with relevant accession numbers .

What approaches can be used to express and purify recombinant Pongo abelii SYS1 protein?

Expressing and purifying recombinant Pongo abelii SYS1 protein presents several challenges due to its nature as an integral membrane protein. A methodological approach to successful expression and purification requires careful consideration of expression systems, solubilization strategies, and purification techniques.

Expression Systems Comparison

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coliCost-effective, high yieldPotential misfolding of membrane proteinsUse of specialized strains (C41/C43), fusion tags (MBP, SUMO)
Insect cellsBetter membrane protein foldingHigher cost, longer production timeBaculovirus optimization, growth at lower temperatures
Mammalian cellsNative-like post-translational modificationsHighest cost, complex maintenanceStable cell line development, inducible expression systems

For optimal expression, a codon-optimized synthetic gene based on the transcript sequence (XM_009233631.2) should be designed . For membrane proteins like SYS1, expression in eukaryotic systems often yields better results due to the presence of appropriate cellular machinery for membrane protein insertion and folding.

Purification strategies should include initial solubilization using mild detergents (such as DDM, LMNG, or MNG-3) followed by affinity chromatography using a fusion tag (His6, FLAG, or Strep-tag II). Size exclusion chromatography as a final polishing step helps achieve high purity while maintaining the native structure of the protein. Throughout the purification process, protein stability should be monitored using techniques such as differential scanning fluorimetry or limited proteolysis.

How can researchers design experiments to study SYS1 interactions with ARFRP1?

Studying the interaction between Pongo abelii SYS1 and ARFRP1 requires a multi-faceted experimental approach that combines in vitro and cellular methods. Given that SYS1 may function as a receptor for ARFRP1 (as noted by similarity) , establishing this interaction experimentally is crucial for understanding the protein's role in Golgi trafficking.

Recommended Experimental Design:

  • In vitro binding assays: Using purified recombinant proteins, researchers can perform pull-down assays, surface plasmon resonance (SPR), or isothermal titration calorimetry (ITC) to quantify binding affinities and kinetics.

  • Co-immunoprecipitation studies: In cell lysates expressing tagged versions of both proteins, co-IP can confirm their interaction in a cellular context.

  • Proximity labeling approaches: BioID or APEX2 fusion proteins can identify proteins in close proximity to SYS1 in living cells, potentially confirming ARFRP1 as an interacting partner.

  • Fluorescence-based interaction assays: Techniques such as Förster Resonance Energy Transfer (FRET), Bimolecular Fluorescence Complementation (BiFC), or fluorescence correlation spectroscopy (FCS) can detect protein interactions in living cells.

Single-subject experimental designs (SSEDs) can be particularly useful for studying protein interactions in this context . For example, a multiple baseline design across different cell conditions or a changing criterion design with varying expression levels can provide robust evidence of interaction specificity. These designs should include appropriate controls and follow the evidence standards outlined by research panels such as the WWCH panel for rigorous experimental validation .

How does Pongo abelii SYS1 compare to SYS1 homologs in other species?

Comparative analysis of SYS1 proteins across species provides valuable insights into conserved functional domains and species-specific adaptations. The Pongo abelii SYS1 homolog shows significant conservation with human SYS1, reflecting their close evolutionary relationship, while displaying more distant homology with other mammalian and non-mammalian species.

Interspecies Comparison of SYS1 Proteins

The high conservation between human and Pongo abelii SYS1 suggests that findings from studies of the orangutan protein may have direct relevance to human biology. Comparative genomics resources available through Ensembl provide tools for further exploring these evolutionary relationships through homologues identification and gene tree analysis .

When designing experiments using recombinant Pongo abelii SYS1, researchers should consider how species-specific differences might affect interpretation of results, particularly when exploring protein-protein interactions or regulatory mechanisms. The available transcript variant information (XM_009233631.2 and XM_009233631.1) can be compared with variants in other species to understand alternative splicing conservation across evolutionary lineages.

What are the methods for analyzing post-translational modifications of SYS1?

Post-translational modifications (PTMs) play crucial roles in regulating protein function, localization, and stability. For membrane proteins like SYS1, PTMs are particularly important in controlling trafficking and protein-protein interactions. Several complementary methods can be employed to comprehensively analyze PTMs on Pongo abelii SYS1.

Mass spectrometry-based proteomics represents the gold standard for PTM identification and characterization. A workflow for analyzing SYS1 PTMs would typically involve:

  • Sample preparation: Enrichment of SYS1 protein through immunoprecipitation or expression of tagged recombinant protein

  • PTM-specific enrichment: For phosphorylation, techniques such as titanium dioxide (TiO2) or immobilized metal affinity chromatography (IMAC); for glycosylation, lectin affinity chromatography

  • LC-MS/MS analysis: High-resolution mass spectrometry with fragmentation methods optimized for PTM identification (e.g., ETD for phosphorylation, HCD for glycosylation)

  • Data analysis: Using specialized software like MaxQuant, Proteome Discoverer, or PTM-specific tools

Complementary approaches include site-directed mutagenesis of predicted modification sites followed by functional assays to determine the biological significance of specific PTMs. For example, potential phosphorylation sites can be mutated to either phospho-null (Ser/Thr to Ala) or phospho-mimetic (Ser/Thr to Asp/Glu) variants to assess their impact on SYS1 function.

For studying dynamics of PTMs, pulse-chase experiments combined with immunoprecipitation and mass spectrometry can provide temporal insights into modification patterns during protein trafficking or in response to cellular stimuli. Single-subject experimental design principles can be applied to these studies by establishing baseline PTM patterns followed by interventions that potentially alter modification status .

How can researchers validate antibodies for detecting Pongo abelii SYS1 protein?

Antibody validation is critical for ensuring reliable detection of SYS1 protein in research applications. For Pongo abelii SYS1, comprehensive validation should follow a multi-step process aligned with best practices in antibody validation.

Comprehensive Antibody Validation Protocol

  • Genetic validation: The most stringent approach involves testing antibody reactivity in samples where the SYS1 gene has been knocked out or knocked down. This can be achieved using CRISPR-Cas9 genome editing or RNAi approaches in cell lines. The complete absence of signal in knockout/knockdown samples provides strong evidence of specificity.

  • Recombinant protein validation: Testing antibody reactivity against purified recombinant Pongo abelii SYS1 protein using western blotting and ELISA. The protein can be expressed using transcript information available in databases (XM_009233631.2) . Both tagged and untagged versions should be tested to account for potential tag interference.

  • Cross-reactivity assessment: Due to the high sequence similarity between Pongo abelii SYS1 and homologs from other species, cross-reactivity testing is essential. This involves testing the antibody against recombinant SYS1 proteins from human and other closely related species.

  • Immunoprecipitation-mass spectrometry: Performing immunoprecipitation followed by mass spectrometry analysis to confirm that the antibody specifically pulls down SYS1 and identify any off-target binding.

  • Orthogonal detection methods: Comparing antibody-based detection with orthogonal methods such as RNA-seq or targeted proteomics to confirm correlation between protein levels and gene expression.

When designing experimental validation, single-subject experimental design principles can be applied by testing antibody performance across different conditions, tissue types, or expression levels . Proper validation requires multiple independent experiments with appropriate controls, following the evidence standards that recommend a minimum of five supporting studies for establishing reliability .

What are the best expression systems for producing functional recombinant SYS1?

Selecting the optimal expression system for producing functional recombinant Pongo abelii SYS1 requires careful consideration of the protein's characteristics as an integral membrane protein linking to the trans-Golgi network . Each expression system offers distinct advantages and limitations that must be weighed against specific research objectives.

Mammalian expression systems, particularly HEK293 and CHO cells, represent the gold standard for expressing recombinant Pongo abelii SYS1 when native folding and post-translational modifications are critical. These systems provide the appropriate cellular machinery for proper membrane insertion and trafficking of Golgi-associated proteins. For small-scale functional studies, transient transfection using lipid-based reagents offers rapid results, while stable cell lines are preferable for consistent long-term production. The use of inducible promoters (such as tetracycline-responsive systems) allows controlled expression to mitigate potential toxicity issues.

Insect cell expression using baculovirus vectors (particularly in Sf9 or High Five cells) offers a compelling alternative that balances higher yields with eukaryotic processing capabilities. For membrane proteins like SYS1, insect cells often provide superior folding compared to prokaryotic systems while being more cost-effective than mammalian cells. Optimization strategies include using honeybee melittin signal sequences for improved secretion and expression at lower temperatures (22-27°C) to enhance proper folding.

How should researchers approach experimental design for SYS1 functional studies?

Designing robust experiments to study SYS1 function requires careful consideration of controls, variables, and appropriate methodologies. Single-subject experimental designs (SSEDs) offer particularly valuable approaches for studying specific aspects of SYS1 function in cellular contexts .

When designing functional studies for Pongo abelii SYS1, researchers should consider implementing multiple baseline designs across different experimental conditions. This approach allows for systematic evaluation of SYS1 function under varying cellular environments or with different interaction partners . For example, trafficking studies could establish baseline localization patterns across different cell types before introducing experimental manipulations such as drug treatments or co-expression with putative interaction partners.

To meet evidence standards for SSED studies, experiments should include:

  • A clearly defined target behavior or outcome (e.g., protein localization, trafficking rate, or interaction strength)

  • Repeated measurement of the dependent variable over time

  • Baseline data collection before intervention

  • Visual analysis of results supported by appropriate quantitative measures

  • At least three demonstrations of experimental effect

For results to be considered robust evidence of SYS1 function, findings should be replicated across multiple experimental sessions and ideally across different laboratories. The WWCH panel standards recommend a minimum of five supporting studies conducted by at least three different research teams at three different geographical locations .

What techniques are most effective for studying SYS1 localization and trafficking?

Investigating the localization and trafficking dynamics of Pongo abelii SYS1 requires sophisticated imaging and biochemical approaches. As an integral membrane protein linking to the trans-Golgi network , SYS1's dynamic movement through cellular compartments provides critical insights into its function in protein trafficking pathways.

Live-cell imaging with fluorescently tagged SYS1 represents the most direct approach for visualizing protein dynamics in real-time. Following the methodology used for related proteins like SYS-1/β-catenin , researchers can generate constructs with fluorescent protein tags such as VENUS yellow fluorescent protein. For optimal results, the tag should be positioned to minimize interference with trafficking signals, typically at either the N- or C-terminus with flexible linker sequences. Spinning disk confocal microscopy or total internal reflection fluorescence (TIRF) microscopy provides the temporal and spatial resolution necessary for tracking SYS1 movement between cellular compartments.

Complementary to live imaging, immunofluorescence microscopy using validated antibodies against SYS1 or epitope tags allows co-localization studies with markers for different cellular compartments. This approach is particularly valuable for defining the steady-state distribution of SYS1 across the secretory pathway. Quantitative co-localization analysis using Pearson's or Manders' coefficients provides objective measures of protein localization patterns.

For biochemical characterization of SYS1 trafficking, subcellular fractionation combined with western blotting offers a quantitative approach to measuring protein distribution across cellular compartments. This can be particularly useful for comparing wild-type and mutant versions of the protein or for assessing changes in localization in response to experimental manipulations.

How can researchers analyze data from SYS1 functional studies?

Data analysis for SYS1 functional studies requires rigorous approaches that combine visual assessment with appropriate statistical methods. For studies using single-subject experimental designs (SSEDs), visual analysis remains a fundamental component but should be complemented with quantitative measures .

Visual analysis of SSED data involves evaluating patterns across different phases of the experiment (baseline, intervention, maintenance) to identify level changes, trend changes, and latency of changes . For SYS1 studies, this might involve visually comparing localization patterns or interaction strengths across different experimental conditions. The strength of visual analysis lies in its ability to detect pattern changes that might be missed by statistical approaches that aggregate data.

  • Percent non-overlapping data (PND): Calculating the percentage of intervention phase data points that exceed the highest (or lowest) baseline phase data point

  • Tau-U: A non-overlap index that controls for baseline trend and is particularly useful for small datasets

  • Standardized mean difference (SMD): Comparing mean differences between phases, standardized by standard deviation

For more complex datasets, such as those involving time-series measurements of protein trafficking or interaction dynamics, more sophisticated statistical approaches may be warranted. These might include mixed-effects models that can account for both fixed effects (experimental conditions) and random effects (biological variability) or time-series analysis methods that can identify temporal patterns in protein behavior.

Regardless of the specific analytical approach, researchers should adhere to the evidence standards recommended by expert panels. According to the WWCH panel, establishing an intervention as evidence-based requires multiple studies meeting methodological standards and conducted by different research teams .

Future Research Directions for Pongo abelii SYS1 Studies

The study of Recombinant Pongo abelii Protein SYS1 homolog presents numerous opportunities for advancing our understanding of protein trafficking mechanisms in primates. Several promising research directions emerge from current knowledge about this integral membrane protein linking to the trans-Golgi network .

Comparative analyses between Pongo abelii SYS1 and its homologs in humans and other primates represent a particularly valuable avenue for research. Given the close evolutionary relationship between orangutans and humans, such studies could provide insights into conserved trafficking mechanisms with potential relevance to human health and disease. The availability of genomic resources through databases like Ensembl facilitates such comparative approaches.

Structure-function studies represent another critical area for future research. While the amino acid sequence of Pongo abelii SYS1 is known , detailed structural information remains limited. Cryo-electron microscopy or X-ray crystallography studies of purified recombinant SYS1 would provide valuable insights into the protein's membrane topology and potential interaction surfaces, particularly those involved in binding ARFRP1.

The application of advanced microscopy techniques, such as super-resolution microscopy and single-molecule tracking, could reveal previously unappreciated aspects of SYS1 trafficking dynamics. These approaches could be particularly valuable for understanding how SYS1 contributes to maintaining Golgi structure and function under various cellular conditions.

Finally, the potential role of SYS1 in disease processes merits exploration. While current research focuses primarily on basic cellular functions, investigating whether alterations in SYS1 expression or function contribute to pathological conditions could open new avenues for therapeutic intervention. Single-subject experimental designs (SSEDs) could be particularly valuable for such translational research, allowing detailed characterization of cellular phenotypes under normal and pathological conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.