Recombinant Pongo abelii Protein YIPF1 (YIPF1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Pongo abelii (Sumatran orangutan) Protein YIPF1 is a laboratory-engineered version of the YIPF1 protein, a member of the Yip1 domain family (YIPF). This family consists of multi-span transmembrane proteins localized in the Golgi apparatus, implicated in vesicular trafficking, Golgi structure maintenance, and glycosylation processes . The recombinant form is produced for research purposes to study its structural, functional, and biochemical properties.

Functional Insights

YIPF1 functions in Golgi-mediated processes through interactions with key partners:

Key Roles

  • Golgi Reassembly: Knockdown of YIPF1 delays post-BFA (brefeldin A) Golgi reassembly, suggesting a role in structural recovery .

  • Glycosylation: YIPF1 supports glycan synthesis, as its depletion reduces intracellular glycans in HT-29 cells .

  • Complex Formation: Forms stable complexes with YIPF6 (a YIPFα homolog) to stabilize Golgi localization .

Interactions

Partner ProteinFunctional OutcomeReference
YIPF6Stabilizes YIPF1 expression and Golgi localization
YIPF2Cooperates in Golgi reassembly and glycan synthesis
COPII ComponentsRecruits cargo to ER-derived vesicles (human homolog)

Research Applications

Recombinant YIPF1 is utilized in:

  • Mechanistic Studies: Elucidating YIPF protein interactions in vesicle trafficking and Golgi dynamics.

  • Disease Models: Investigating roles in ER stress responses (e.g., IRE1/PERK activation) .

  • Biochemical Assays: Analyzing transmembrane protein oligomerization and topology .

Key Research Findings

Recent studies highlight YIPF1’s multifaceted roles:

Study FocusKey ResultImplicationReference
Golgi Reassembly Post-BFAYIPF1 knockdown delays Golgi recovery, unlike YIPF6 knockdown Highlights distinct roles in Golgi dynamics
Glycan SynthesisYIPF1 depletion reduces glycans, linking it to glycosylation pathways Supports role in post-translational modification
ER Stress ResponseYIPFα1A (human homolog) activates IRE1/PERK under stress Suggests conserved stress adaptation roles
Pathogen InteractionsYIPFα1A required for Brucella-induced ER stress response Links YIPF proteins to infection mechanisms

Future Directions

Further research is needed to:

  • Resolve the atomic structure of YIPF1 complexes.

  • Define its role in ER-Golgi cargo sorting.

  • Explore therapeutic potential in ER stress-related diseases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YIPF1; Protein YIPF1; YIP1 family member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
YIPF1
Target Protein Sequence
MAAVDDLQFEEFGNAATSLTANPDATTVNIEDPGETPKHQSGSPRGSGREEDDELLGNDD SDKTELLAGQKKSSPFWTFEYYQTFFDVDTYQVFDRIKGSLLPIPGKNFVRLYIRSNPDL YGPFWICATLVFAIAISGNLSNFLIHLGEKTYRYVPEFRKVSIAATTIYAYAWLVPLALW GFLMWRNSKVMNIVSYSFLEIVCVYGYSLFIYIPTAILWIIPQKAVRWILVMIALGISGS VLAMTFWPAVREDNRRVALATIVTIVLLHMLLSVGCLAYFFDAPEMDHLPTTTATPNQTV AAAKSS
Uniprot No.

Target Background

Database Links

KEGG: pon:100172394

UniGene: Pab.10692

Protein Families
YIP1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane. Late endosome membrane.

Q&A

What is YIPF1 and what is its fundamental role in cellular function?

YIPF1 (YIP1 family member 1) is a membrane protein belonging to the Yip superfamily of membrane-shaping adapter proteins (MSAPs) . The protein from Pongo abelii (Sumatran orangutan) consists of 306 amino acids with multiple transmembrane domains . YIPF1 plays crucial roles in intracellular membrane trafficking, particularly in vesicle formation and transport between the ER and Golgi apparatus .

Studies of YIPF1 homologs, particularly in yeast (Yip1p), have demonstrated that these proteins form heteromeric integral membrane complexes essential for the biogenesis of ER-derived COPII vesicles . YIPF1 functions through interactions with Rab GTPases (Ypt proteins in yeast), suggesting a role in regulating vesicle budding, trafficking, and fusion processes . Loss of function in related Yip proteins leads to accumulation of ER membranes and aberrant protein secretion and glycosylation, highlighting their importance in the secretory pathway .

How is YIPF1 conserved across species compared to the Pongo abelii variant?

While the search results don't provide specific cross-species conservation data for YIPF1, they indicate that Yip family proteins are evolutionarily conserved from yeast to mammals . Despite low amino acid homology (<1%) among yeast Yip family members, these proteins share similar membrane topology with multiple transmembrane domains and extended terminal regions .

The conservation of function appears more significant than sequence homology, as evidenced by the consistent roles of Yip proteins in membrane trafficking across diverse species. Studies have shown that Yip proteins interact with Rab GTPases (Ypt in yeast) across species boundaries, suggesting conservation of fundamental interaction mechanisms despite sequence divergence .

What expression systems are available for recombinant Pongo abelii YIPF1 production?

Based on available commercial offerings, researchers have multiple expression system options for recombinant Pongo abelii YIPF1 production:

Expression SystemAdvantagesProduct Code Example
E. coliHigh yield, cost-effective, rapid productionCSB-EP712883PYX
YeastPost-translational modifications, membrane protein foldingCSB-YP712883PYX
BaculovirusComplex protein folding, higher eukaryotic modificationsCSB-BP712883PYX
Mammalian cellMost native-like post-translational modificationsCSB-MP712883PYX

The choice of expression system should depend on the specific research requirements. For structural studies requiring large protein quantities, bacterial systems may be preferred. For functional studies requiring proper folding and post-translational modifications, eukaryotic systems (particularly mammalian cells) would be more appropriate .

What purification strategies are most effective for maintaining YIPF1 functionality?

Membrane proteins like YIPF1 present unique purification challenges due to their hydrophobic nature and requirement for lipid environments to maintain native conformation. While the search results don't provide specific purification protocols for YIPF1, general approaches for membrane proteins would apply:

  • Detergent Solubilization: Selection of appropriate detergents is critical for extracting YIPF1 from membranes while preserving its structure and function. Mild detergents like DDM (n-Dodecyl β-D-maltoside) are often suitable starting points.

  • Affinity Purification: The recombinant protein can be produced with affinity tags to facilitate purification. For example, products are available with Avi-tag biotinylation for streptavidin-based purification systems .

  • Storage Conditions: According to product information, purified YIPF1 is typically stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage . Repeated freeze-thaw cycles should be avoided to maintain protein integrity.

Working aliquots can be stored at 4°C for up to one week to minimize degradation during active experimentation periods .

What methodologies are most effective for studying YIPF1's interactions with Rab GTPases?

Based on studies of Yip family proteins, several complementary approaches can be used to investigate YIPF1-Rab interactions:

  • Yeast Two-Hybrid (Y2H) Screening: This was successfully used to identify Yip1p interactions with Ypt proteins in yeast . For YIPF1, the cytosolic N-terminal domain would be the focus for these interaction studies.

  • Affinity Chromatography: Pull-down assays using immobilized Rab GTPases (in both GDP and GTP-bound states) can identify direct physical interactions with YIPF1 .

  • Co-immunoprecipitation: This technique can validate interactions in more native contexts and has been used to confirm Yip-Ypt binding in previous studies .

  • Surface Plasmon Resonance (SPR): For quantitative binding kinetics, SPR can measure real-time interactions between purified YIPF1 and various Rab GTPases.

When designing these experiments, it's important to consider the nucleotide-bound state of the Rab GTPases (GDP vs. GTP), as this can significantly affect interaction specificity and affinity. Additionally, truncated versions of YIPF1 focusing on the cytosolic domains may be more manageable for some interaction studies .

How can researchers effectively study YIPF1's role in ER-Golgi trafficking?

To investigate YIPF1's function in ER-Golgi trafficking, researchers can employ several experimental approaches that have proven effective for related Yip proteins:

  • COPII Vesicle Budding Assays: In vitro reconstitution of COPII vesicle formation using purified components can assess YIPF1's direct role in vesicle biogenesis. Previous studies have shown that Yip1p is required for the biogenesis of ER-derived COPII vesicles .

  • Vesicle Isolation and Proteomics: COPII vesicles can be isolated and analyzed for YIPF1 content, similar to studies showing that Yip1p, Yip3p, and Yif1p are efficiently packaged into these vesicles .

  • Cargo Transport Assays: Monitoring the trafficking of model cargo proteins between the ER and Golgi in the presence of wildtype versus mutant YIPF1 can reveal functional impacts on transport.

  • Fluorescence Microscopy: Techniques like FRAP (Fluorescence Recovery After Photobleaching) can track YIPF1 dynamics between compartments. Previous characterization of Got1p, a suppressor of yip1 mutations, revealed that this protein cycles rapidly between the ER and Golgi compartments .

  • Genetic Interaction Studies: Identification of genetic suppressors, like the multicopy suppressors (GOT1, FYV8, TSC3) identified for yip1-2 in yeast, can provide insight into YIPF1's functional network .

These methods can be combined to build a comprehensive understanding of YIPF1's specific contributions to membrane trafficking pathways.

What is known about YIPF1's role in membrane curvature and vesicle formation?

While the search results don't provide specific details about YIPF1's role in membrane curvature, insights can be drawn from studies of related proteins in the Yip family. Yip family proteins, including Yop1p (Yip2p), have been categorized as membrane-shaping adapter proteins (MSAPs) .

Research has shown that Yip1p is involved in early-stage ER/COPII vesicle budding, with a hypothesis that vesicle biogenesis is coupled to cargo loading . The Yip1p/Yif1p complex has been found to be necessary for making ER-derived vesicles "fusion competent" through interactions with SNARE proteins (e.g., Bos1 and Sec22) that are essential for ER/Golgi fusion .

For experimental investigation of YIPF1's membrane-shaping capabilities, researchers might consider:

  • Liposome Deformation Assays: In vitro reconstitution using purified YIPF1 with artificial liposomes to assess its ability to induce membrane curvature.

  • Electron Microscopy: Visualization of membrane morphology in cells overexpressing or depleted of YIPF1 to observe changes in organelle structure, particularly ER and Golgi.

  • Genetic Interaction with COPII Components: The finding that GOT1, a suppressor of yip1 mutations, also showed moderate suppressor activity toward temperature-sensitive mutations in SEC23 and SEC31 genes (which encode COPII coat subunits) suggests functional connections between Yip proteins and the vesicle formation machinery .

How do mutations in YIPF1 affect its function in membrane dynamics?

Studies on yeast Yip1p provide insights into how mutations might affect YIPF1 function:

  • Temperature-Sensitive Alleles: The yip1-2 thermosensitive allele has been valuable for studying Yip1p function, allowing conditional inactivation of the protein . Similar conditional mutations could be introduced into Pongo abelii YIPF1 for functional studies.

  • Multicopy Suppressors: Research identified GOT1, FYV8, and TSC3 as novel high-copy suppressors of the yip1-2 allele, with GOT1 being the strongest suppressor . These genetic interactions provide clues to functional networks that might be conserved in YIPF1.

  • Functional Domains: Mutations affecting the cytosolic N-terminal domain would likely disrupt interactions with Rab GTPases, while mutations in transmembrane regions might affect membrane integration or protein-protein interactions within the membrane .

For experimental analysis of YIPF1 mutations, researchers could employ:

  • Site-Directed Mutagenesis: Creating specific mutations in conserved residues or domains.

  • Complementation Assays: Testing whether mutant YIPF1 variants can rescue phenotypes in cells depleted of endogenous YIPF1.

  • Protein-Protein Interaction Analysis: Assessing how mutations affect YIPF1's ability to interact with Rab GTPases and other binding partners.

What experimental controls are essential when studying recombinant YIPF1 function?

When investigating recombinant YIPF1 function, several critical controls should be implemented:

  • Expression Level Verification: Ensure that YIPF1 is expressed at appropriate levels, as overexpression could lead to artifactual effects. Western blotting with anti-YIPF1 antibodies or tag-specific antibodies should be performed.

  • Subcellular Localization Confirmation: Verify that recombinant YIPF1 localizes correctly to expected cellular compartments (primarily Golgi and ER-Golgi intermediate compartments) using immunofluorescence or fractionation techniques .

  • Functional Complementation: Demonstrate that the recombinant protein can rescue phenotypes associated with endogenous YIPF1 depletion.

  • Tag Interference Control: For tagged versions of YIPF1, compare the behavior of differently tagged versions (N-terminal vs. C-terminal tags) to ensure the tag doesn't interfere with function .

  • Negative Controls: Include appropriate negative controls such as non-functional YIPF1 mutants, unrelated membrane proteins, or empty vector controls in all experiments.

  • Protein Quality Assessment: Before functional assays, verify protein quality through methods such as size-exclusion chromatography to ensure the absence of aggregation and proper oligomeric state.

How can recombinant Pongo abelii YIPF1 be used in comparative studies with human YIPF1?

Recombinant Pongo abelii YIPF1 can serve as a valuable comparative model for human YIPF1 studies:

  • Evolutionary Conservation Analysis: Direct comparison of sequence, structure, and function between orangutan and human YIPF1 can reveal evolutionarily conserved features critical for function versus species-specific adaptations.

  • Structural Studies: Comparing the folding, stability, and biochemical properties of both proteins may identify structural elements that are either conserved or divergent across primates.

  • Functional Complementation: Testing whether Pongo abelii YIPF1 can functionally substitute for human YIPF1 in cellular assays would provide insights into functional conservation.

  • Interaction Partners: Comparative analysis of the interactomes of both proteins could reveal conserved versus species-specific protein-protein interactions.

This comparative approach is particularly valuable because Pongo abelii, as one of our closest evolutionary relatives, provides insights into primate-specific adaptations in membrane trafficking pathways that may not be evident in more distant model organisms like yeast.

What are the emerging techniques for studying membrane protein dynamics applicable to YIPF1 research?

Several cutting-edge technologies could enhance YIPF1 research:

  • Cryo-Electron Microscopy: For structural determination of YIPF1 alone or in complex with interaction partners, potentially revealing the molecular basis of its function in membrane dynamics.

  • Super-Resolution Microscopy: Techniques like STORM or PALM can visualize YIPF1 distribution and dynamics at the nanoscale, providing insights into its spatial organization during vesicle formation.

  • Proximity Labeling: Methods such as BioID or APEX2 can identify proteins in close proximity to YIPF1 in living cells, potentially revealing novel interaction partners or transient associations during vesicle trafficking.

  • Live-Cell Protein-Protein Interaction Imaging: Techniques like Förster Resonance Energy Transfer (FRET) or Bimolecular Fluorescence Complementation (BiFC) can visualize YIPF1 interactions with Rab GTPases or other partners in real-time.

  • Nanodiscs or Membrane Mimetics: These systems allow for the study of purified YIPF1 in near-native lipid environments, enabling more precise biochemical and biophysical characterization.

These advanced methodologies could help bridge current knowledge gaps regarding YIPF1's precise molecular functions and dynamics in membrane trafficking pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.