Recombinant Pongo abelii Receptor expression-enhancing protein 4 (REEP4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
REEP4; Receptor expression-enhancing protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
REEP4
Target Protein Sequence
MVSWMICRLVVLVFGMLCPAYASYKAVKTKNIREYVRWMMYWIVFALFMAAEIITDIFIS WFPFYYEIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYETVLS FGKRGLNIAASAAVQAATKSQGALAGRLRSFSMQDLRAIPDAPAPAYHDPLYLEDQVPHQ RPPIGYRAGGLQDSDTEDECWSDTEAVPRAPARPREKPLIRSQSLRVVKRKPPVREGTSR SLKVRTRKKTVPSDMDS
Uniprot No.

Target Background

Function

REEP4 is a microtubule-binding protein essential for proper cell division and nuclear envelope reassembly. Its function involves sequestering the endoplasmic reticulum from chromosomes during mitosis, likely by clearing the endoplasmic reticulum membrane from metaphase chromosomes.

Database Links
Protein Families
DP1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is REEP4 and what is its primary function in cellular systems?

REEP4 (Receptor expression-enhancing protein 4) is a reticulon homology domain (RHD) protein primarily involved in shaping high-curvature membranes of the endoplasmic reticulum. Unlike other RHD proteins that are predominantly localized to the peripheral ER, REEP4 demonstrates an unusual dual localization pattern, being significantly enriched in the nuclear fraction compared to other RHD proteins . REEP4's primary functions include:

  • Creating and maintaining high-curvature ER membrane structures during mitosis

  • Contributing to nuclear pore complex (NPC) assembly, particularly during post-mitotic nuclear envelope reformation

  • Coordinating between ER membrane dynamics and nuclear envelope architecture

Functionally, REEP4 works in conjunction with the closely related REEP3 to position and shape the ER during mitosis, suggesting specialized roles during cell division .

How is REEP4 localized within cellular compartments?

REEP4 demonstrates a unique dual localization pattern:

  • Cytoplasmic ER localization: As expected for a reticulon homology domain protein, REEP4 associates with high-curvature membranes of the peripheral endoplasmic reticulum

  • Nuclear rim localization: Unlike other RHD proteins, REEP4 also shows significant enrichment at the nuclear envelope, specifically at the inner nuclear membrane (INM)

This dual localization is functionally significant as it enables REEP4 to serve as a bridge between ER membrane dynamics and nuclear pore complex assembly. Proteomics studies have confirmed this unusual distribution pattern, detecting REEP4 as significantly enriched in nuclear fractions compared to other related proteins .

What is the relationship between REEP4 and nuclear pore complex biogenesis?

REEP4 plays a specialized role in nuclear pore complex (NPC) biogenesis, particularly during post-mitotic assembly. Research indicates that:

  • REEP4 is recruited to the inner nuclear membrane (INM) by the NPC biogenesis factor ELYS

  • REEP4 depletion results in approximately 20% reduction in NPC densities, compared to 40% reduction observed with ELYS depletion

  • The effect of REEP4 depletion is more pronounced in G1 cells than in mixed interphase populations, suggesting a predominant role in post-mitotic assembly

The functional relationship between REEP4 and NPCs appears to involve coordination between high-curvature membrane provision and the ELYS-based NPC seed during late mitosis. This coordination enhances the efficiency of NPC assembly during nuclear envelope reformation .

How does REEP4 interact with ELYS to facilitate NPC assembly?

The interaction between REEP4 and ELYS represents a crucial coordination mechanism between membrane dynamics and NPC assembly. Research findings indicate that:

  • ELYS serves as a determinant for REEP4 targeting to the inner nuclear membrane

  • The two proteins are detected in close proximity within cells and may interact directly

  • ELYS, which binds to chromatin during late mitosis, appears to recruit REEP4 to these sites

  • This recruitment may facilitate the association of high-curvature ER membranes (possibly nanoholes) with chromatin-bound ELYS during the early stages of post-mitotic NPC formation

This interaction suggests a model where REEP4 aids in providing appropriately curved membrane structures to nascent NPCs, enhancing assembly efficiency without being absolutely essential for the process .

What experimental evidence demonstrates REEP4's role in post-mitotic NPC assembly?

Several experimental approaches have established REEP4's contribution to post-mitotic NPC assembly:

  • Cell cycle-specific analysis: Using CENP-F as a marker for early interphase (G1) cells, researchers demonstrated that REEP4 depletion had a more pronounced effect on NPC density in G1 cells compared to mixed interphase populations

  • Nucleoporin analysis: Examination of specific nucleoporins (ELYS and RanBP2) showed significantly larger reduction in their nuclear envelope densities in G1 cells following REEP4 RNAi

  • Comparative depletion studies: While ELYS depletion leads to approximately 40% reduction in NPC densities, REEP4 RNAi results in approximately 20% reduction, consistent with a supportive rather than essential role

These findings collectively indicate that REEP4 contributes primarily to post-mitotic NPC assembly, aligning with its known role in shaping ER during mitosis .

What are the optimal conditions for handling recombinant Pongo abelii REEP4?

For researchers working with recombinant Pongo abelii REEP4, the following storage and handling conditions are recommended:

ParameterRecommendation
Storage temperature-20°C for regular use; -80°C for extended storage
Buffer compositionTris-based buffer with 50% glycerol, optimized for protein stability
Working concentrationStore working aliquots at 4°C for up to one week
Freeze-thaw cyclesRepeated freezing and thawing is not recommended
ReconstitutionIf lyophilized, reconstitute in appropriate buffer with 50% glycerol

These conditions are designed to maintain protein stability and activity for experimental applications .

What experimental approaches are recommended for studying REEP4's dual localization?

To effectively study REEP4's localization to both the ER and nuclear envelope, researchers should consider these methodological approaches:

  • Subcellular fractionation: Separate nuclear and ER fractions to quantitatively assess REEP4 distribution between compartments

  • Immunofluorescence microscopy: Use co-localization studies with markers for:

    • Nuclear envelope (e.g., lamin proteins)

    • Nuclear pore complexes (e.g., ELYS, RanBP2)

    • ER membranes (e.g., calreticulin)

  • Cell cycle synchronization: Compare REEP4 localization across different cell cycle stages, particularly during mitotic exit and G1 entry

  • Proximity labeling techniques: Use BioID or APEX2 fusions to identify proteins in close proximity to REEP4 in different cellular compartments

These approaches can provide complementary data on the dynamic localization patterns of REEP4 throughout the cell cycle.

How can researchers effectively study REEP4's role in NPC assembly?

To investigate REEP4's specific contribution to NPC assembly, researchers should consider these methodological approaches:

These approaches can provide mechanistic insights into REEP4's specific role in coordinating membrane dynamics with NPC assembly.

What are the key unresolved questions regarding REEP4's role in NPC biogenesis?

Several important questions remain to be addressed regarding REEP4's function in NPC assembly:

  • Structural basis of interaction: What are the specific domains or residues mediating REEP4-ELYS interaction?

  • Temporal dynamics: What is the precise timing of REEP4 recruitment to chromatin-bound ELYS during mitotic exit?

  • Curvature mechanism: How does REEP4 generate or stabilize the high-curvature membrane structures required for NPC insertion?

  • Regulatory factors: What signals or modifications regulate REEP4's distribution between the peripheral ER and nuclear envelope?

  • Species differences: How conserved is REEP4's dual function across different species, and are there primate-specific adaptations in Pongo abelii REEP4?

Addressing these questions will require integrated approaches combining structural biology, advanced imaging, and genome engineering techniques.

How might REEP4 research inform broader understanding of nuclear envelope dynamics?

Research on REEP4 has potential implications for broader understanding of nuclear envelope biology:

  • Membrane-chromatin interactions: REEP4's role may illuminate general principles of how curved membranes interact with chromatin during nuclear envelope reformation

  • Coordination mechanisms: The REEP4-ELYS interaction represents a model for studying how protein assembly processes are coordinated with membrane dynamics

  • Cell cycle regulation: Understanding REEP4's cell cycle-specific functions may reveal regulatory principles governing nuclear envelope architecture during transitions between interphase and mitosis

  • Evolutionary adaptations: Comparing REEP4 function across species might reveal evolutionary adaptations in nuclear envelope organization

These broader implications highlight the significance of REEP4 research beyond its specific role in NPC biogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.