Recombinant Pongo abelii Receptor expression-enhancing protein 5 (REEP5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
REEP5; DP1; Receptor expression-enhancing protein 5; Polyposis locus protein 1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCN LIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGF LLWCMAPSPSNGAELLYKRIIRPFFLKHESQVDSVVKDLKDKAKETADAITKEAKKATVN LLGEEKKST
Uniprot No.

Target Background

Function
May promote functional cell surface expression of olfactory receptors.
Database Links
Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein. Endoplasmic reticulum.

Q&A

What is REEP5 and what is its primary function in cellular biology?

REEP5 (Receptor Expression-Enhancing Protein 5) is a membrane protein that plays a critical role in shaping and maintaining the structure of the sarco-endoplasmic reticulum (SR/ER). It is also known as Polyposis locus protein 1 homolog. REEP5 belongs to a family of proteins responsible for high-curvature SR/ER tubule formation. In cellular biology, its primary function is to regulate SR/ER membrane organization, particularly in specialized cells with differentiated SR/ER networks like cardiomyocytes. The protein contains a conserved amphipathic helix domain in its C-terminus that is essential for membrane stabilization support .

How does the molecular structure of REEP5 contribute to its function?

REEP5's molecular structure includes several key domains that enable its membrane-shaping functions. The Pongo abelii (Sumatran orangutan) REEP5 has 189 amino acids with a molecular structure that includes transmembrane regions and a cytosolic C-terminus. The protein contains hydrophobic domains that insert into the SR/ER membrane and create local membrane curvature. Particularly important is the C-terminus region in the cytosol, which has been linked to membrane stabilization. Research has shown that overexpression of C-terminus truncated mutants of REEP5 leads to severely vacuolated SR/ER, indicating this domain's critical importance for proper membrane architecture .

What experimental models are most commonly used to study REEP5 function?

Several experimental models have been established to study REEP5 function:

  • In vitro cellular models: Isolated cardiomyocytes with REEP5 knockdown or overexpression

  • Zebrafish models: CRISPR/Cas9-mediated REEP5 loss-of-function zebrafish mutants

  • Rodent models: Mouse models with REEP5 depletion using adeno-associated viral (AAV9) vectors

  • Hypoxia-induced cardiomyocyte models: Used to study REEP5's role in cardiac stress responses

These models have revealed that REEP5 deficiency results in SR membrane destabilization, formation of luminal vacuoles, and compromised cardiac function. In zebrafish, REEP5 loss-of-function mutants showed sensitized cardiac dysfunction upon verapamil treatment. In mice, AAV9-induced REEP5 depletion led to cardiac dysfunction with dilated chambers, increased fibrosis, and reduced ejection fraction .

How does REEP5 regulate sarcoplasmic reticulum architecture in cardiomyocytes?

REEP5 regulates SR architecture through several mechanisms:

  • High-curvature tubule formation: REEP5 is responsible for shaping high-curvature SR tubules that are required for proper association with t-tubules and propagation of cardiac excitation-contraction coupling signals.

  • Protein interactions: REEP5 interacts with several proteins involved in membrane architecture, including members of the reticulon (RTN) and atlastin (ATL) families, as well as cytoskeleton associated protein 4 (CKAP4). These interactions are crucial for high curvature formation, tubule fusion, and intraluminal spacing.

  • C-terminus function: The C-terminus region of REEP5 in the cytosol is critical for membrane stabilization. When this domain is truncated or dysfunctional, severe SR/ER vacuolization occurs.

Focused ion beam scanning electron microscopy–based 3-dimensional reconstruction has visualized how REEP5 inactivation specifically deforms cardiac SR membrane without affecting transverse tubules. Without REEP5, the SR membrane network fails to form high curvature tubules necessary for proper calcium handling and excitation-contraction coupling .

What is the relationship between REEP5 and calcium handling in cardiac physiology?

REEP5 plays a crucial role in calcium handling through its effects on SR organization:

  • SR calcium release: Studies using simultaneous recordings of depolarization-induced Ca²⁺ currents and Ca²⁺ transients in REEP5-null cardiomyocytes have revealed normal L-type Ca²⁺ channel currents but depressed SR Ca²⁺ release.

  • Excitation-contraction coupling: REEP5 deficiency compromises the excitation–contraction coupling gain of cardiomyocytes, leading to reduced cardiac contractility. This occurs despite normal expression levels of major proteins involved in Ca²⁺ handling.

  • SR-T-tubule junctions: REEP5 ensures proper formation of junctions between SR and transverse tubules, which are essential for efficient calcium-induced calcium release during contraction.

The structural deformation of SR in REEP5-deficient cardiomyocytes directly impairs calcium cycling and contractile function, establishing REEP5 as a critical determinant of cardiac contractility through its architectural role rather than by altering calcium handling proteins directly .

How does REEP5 modulate endoplasmic reticulum stress in the context of myocardial infarction?

REEP5 has emerged as a significant modulator of ER stress in myocardial infarction:

  • Downregulation in MI: REEP5 expression is significantly downregulated in the infarct penumbra area of myocardial infarction (MI) mice, as confirmed by Western blot and IHC staining.

  • ER stress pathway inhibition: REEP5 overexpression inhibits ER stress by:

    • Repressing phosphorylation of PERK and IRE1α (key ER stress sensors)

    • Decreasing nuclear translocation of ATF6

    • Reducing levels of active spliced XBP-1 (XBP-1s)

    • Downregulating proapoptotic factors including Chop and cleaved caspase-12

  • Functional improvement: Mice with REEP5 overexpression show improved left ventricular function after MI, including:

    • Reduced left ventricular end-systolic diameter (LVESD)

    • Decreased left ventricular end-systolic volume (LVESV)

    • Lower left ventricular end-diastolic diameter (LVEDD)

    • Reduced left ventricular end-diastolic volume (LVEDV)

    • Improved ejection fraction (EF) and fractional shortening (FS)

    • Reduced infarct size

These findings establish REEP5 as a protective factor against MI-induced cardiac injury through its ability to mitigate ER stress-associated apoptosis .

What is the interaction between REEP5 and CLEC5A in cardiac pathophysiology?

The interaction between REEP5 and C-type lectin member 5A (CLEC5A) represents a novel mechanism in cardiac pathophysiology:

  • Binding interaction: REEP5 has been found to directly bind to CLEC5A, a protein that triggers cardiac dysfunction.

  • Opposing expression patterns: While REEP5 is downregulated in MI, CLEC5A expression is elevated in hypoxia-induced cardiomyocyte models.

  • Functional antagonism: CLEC5A promotes cardiomyocyte apoptosis, whereas REEP5 overexpression markedly abolishes these effects of CLEC5A on ER stress-induced apoptosis.

  • Protein degradation: Research suggests that CLEC5A may promote REEP5 protein degradation, contributing to reduced REEP5 levels during cardiac stress.

This interaction provides a mechanistic explanation for how REEP5 can relieve MI via inhibiting ER stress-induced apoptosis, positioning REEP5 as a mediator that counteracts the detrimental effects of CLEC5A in the stressed heart .

What techniques are optimal for studying REEP5 expression and localization in cardiac tissue?

The following methodological approaches have proven effective for studying REEP5:

  • Western Blot Analysis: Effective for quantifying REEP5 protein expression levels in tissue samples and cell cultures. This technique has been used to demonstrate downregulation of REEP5 in failing hearts and in hypoxic cardiomyocytes.

  • Immunohistochemistry (IHC): Useful for visualizing REEP5 distribution in tissue sections, particularly in the infarct penumbra area of MI mice.

  • Immunofluorescence (IF) Staining: Enables visualization of REEP5 localization relative to other cellular structures and proteins, such as ATF6 nuclear translocation.

  • Focused Ion Beam Scanning Electron Microscopy: Provides high-resolution 3D reconstruction of SR membrane architecture, allowing visualization of how REEP5 deficiency affects SR morphology.

  • Co-immunoprecipitation: Used to identify REEP5's interactions with other proteins, including members of the reticulon and atlastin families, CKAP4, and CLEC5A.

  • Mass Spectrometry: Applied for REEP5 interactome analysis to identify binding partners involved in SR/ER membrane shaping and function .

How can researchers effectively manipulate REEP5 expression in experimental models?

Several approaches have been successfully used to manipulate REEP5 expression:

  • Plasmid-based Overexpression: Transfection of REEP5 overexpression plasmids in cardiomyocytes has been used to study gain-of-function effects, particularly in hypoxia models.

  • CRISPR/Cas9 Technology: Used to generate REEP5 loss-of-function zebrafish mutants, enabling studies of REEP5 deficiency in a vertebrate model system.

  • Adeno-Associated Viral (AAV9) Vectors: Employed for in vivo REEP5 depletion in mouse models, creating cardiac-specific knockdown that results in dilated cardiomyopathy phenotypes.

  • siRNA Knockdown: Useful for in vitro studies to achieve targeted inactivation of REEP5 in cultured cardiomyocytes.

  • Truncation Mutants: Construction of C-terminus truncated mutants of REEP5 has helped identify domain-specific functions, particularly the role of the C-terminus in membrane stabilization.

These techniques should be selected based on the specific research question, considering factors such as temporal control, tissue specificity, and the desired magnitude of expression changes .

What are the key parameters to monitor when studying REEP5's effects on cardiac function?

When investigating REEP5's impact on cardiac function, researchers should monitor:

  • Structural Parameters:

    • SR/ER membrane morphology (using electron microscopy)

    • Presence of luminal vacuolization

    • Cardiac chamber dimensions (LVESD, LVEDD)

    • Cardiac volumes (LVESV, LVEDV)

    • Infarct size (using TTC staining)

    • Cardiac fibrosis

  • Functional Parameters:

    • Ejection fraction (EF) and fractional shortening (FS)

    • Calcium handling (using Ca²⁺ current recordings and Ca²⁺ transient measurements)

    • Excitation-contraction coupling gain

    • Cardiomyocyte contractility

  • Molecular Markers:

    • ER stress markers (phosphorylated PERK and IRE1α, nuclear ATF6, XBP-1s)

    • Apoptotic markers (TUNEL-positive cells, cleaved caspase-12, Chop)

    • Interacting proteins (RTN family, ATL family, CKAP4, CLEC5A)

These parameters provide a comprehensive assessment of how REEP5 manipulation affects cardiac structure, function, and cellular stress responses at multiple levels of biological organization .

What are the optimal storage and handling conditions for recombinant REEP5 protein?

For researchers working with recombinant Pongo abelii REEP5 protein:

  • Storage Conditions:

    • Store at -20°C for regular use

    • For extended storage, conserve at -20°C or -80°C

    • Avoid repeated freezing and thawing

    • Working aliquots can be stored at 4°C for up to one week

  • Buffer Composition:

    • Tris-based buffer with 50% glycerol, optimized for this protein

    • The buffer is specifically formulated to maintain REEP5 stability and function

  • Protein Characteristics:

    • Full amino acid sequence contains 189 amino acids

    • May contain different tag types depending on the production process

    • Available in quantities such as 50 μg, with other quantities available upon request

  • Experimental Considerations:

    • When using for functional studies, researchers should consider the presence of tag sequences that may affect protein function

    • The recombinant protein's stability in experimental conditions should be verified before conducting complex assays .

What evidence supports REEP5 as a therapeutic target for heart failure and myocardial infarction?

Several lines of evidence support REEP5's therapeutic potential:

  • Expression in Disease States:

    • REEP5 is downregulated in failing hearts

    • REEP5 expression is reduced in the infarct penumbra area of MI mice

    • These expression patterns suggest that restoring REEP5 levels could be therapeutically beneficial

  • Gain-of-Function Studies:

    • REEP5 overexpression improves left ventricular function in MI mice

    • REEP5 overexpression reduces infarct size

    • These beneficial effects occur through inhibition of ER stress-induced apoptosis

  • Mechanistic Understanding:

    • REEP5 inhibits key ER stress pathways (PERK, IRE1α, ATF6)

    • REEP5 downregulates proapoptotic factors (Chop, cleaved caspase-12)

    • REEP5 counteracts the detrimental effects of CLEC5A

  • SR Structural Role:

    • REEP5 maintains proper SR architecture, which is essential for cardiac function

    • REEP5-dependent SR shaping represents a novel therapeutic approach distinct from traditional calcium-handling targets

These findings collectively suggest that strategies to increase or preserve REEP5 expression or function could provide novel therapeutic approaches for heart failure and myocardial infarction .

What challenges exist in developing REEP5-targeted therapeutic approaches?

Despite its promise, several challenges must be addressed in developing REEP5-targeted therapies:

  • Delivery Methods:

    • As a membrane protein, REEP5 presents challenges for therapeutic delivery

    • Gene therapy approaches require cardiac-specific targeting

    • Viral vectors (like AAV9) show promise but have limitations regarding immune responses and delivery efficiency

  • Mechanistic Gaps:

    • The precise molecular mechanism by which REEP5 regulates ROS production needs further elucidation

    • Additional research is needed to understand how REEP5 interacts with the ER stress pathways in myocytes

    • The complete REEP5 interactome in cardiac cells remains to be fully characterized

  • Clinical Translation:

    • Genetic studies in idiopathic cardiomyopathy cases are warranted to identify potential REEP5-related etiology

    • Biomarkers for REEP5 function would help identify patients who might benefit from REEP5-targeted therapies

    • The timing of intervention may be critical, as REEP5's role might differ in acute versus chronic cardiac conditions

  • Specificity Concerns:

    • REEP5 affects fundamental SR/ER processes, raising concerns about off-target effects

    • Tissue-specific approaches would be necessary to avoid disrupting REEP5 function in other cell types

Addressing these challenges will be essential for translating the promising preclinical findings on REEP5 into viable therapeutic strategies for heart disease .

What are the most promising areas for future REEP5 research?

Several key areas warrant further investigation:

  • Genetic Association Studies:

    • Investigating REEP5 mutations or polymorphisms in familial cardiomyopathy and heart failure cases

    • Exploring REEP5 genetic variants as risk factors for adverse cardiac remodeling after myocardial infarction

  • Mechanistic Research:

    • Determining the precise molecular mechanism by which REEP5 regulates reactive oxygen species (ROS) production

    • Further characterizing the REEP5-CLEC5A interaction and its regulatory mechanisms

    • Investigating the role of REEP5 in mitochondria-associated ER membranes (MAMs) and their function in cardiac cells

  • Therapeutic Development:

    • Designing small molecules that could stabilize REEP5 or enhance its function

    • Developing cardiac-specific gene therapy approaches to restore REEP5 expression

    • Exploring the potential of REEP5-derived peptides in maintaining SR/ER structure

  • Broader Disease Relevance:

    • Investigating REEP5's role in other conditions involving ER stress, such as diabetic cardiomyopathy

    • Examining REEP5 function in different cell types beyond cardiomyocytes, including vascular cells and fibroblasts

  • Biomarker Development:

    • Evaluating whether circulating REEP5 levels could serve as biomarkers for cardiac stress or damage

    • Determining if REEP5 expression patterns correlate with response to existing heart failure therapies

These research directions could significantly advance our understanding of REEP5's role in cardiac health and disease, potentially leading to novel diagnostic and therapeutic approaches .

How might REEP5 research intersect with other emerging areas in cardiovascular medicine?

REEP5 research intersects with several cutting-edge areas in cardiovascular medicine:

  • Precision Medicine:

    • REEP5 genetic variants or expression patterns could help stratify heart failure patients

    • Personalized approaches may target specific ER stress pathways based on individual REEP5 status

  • Regenerative Medicine:

    • REEP5's role in SR/ER organization may influence cardiomyocyte maturation and function

    • Understanding REEP5 could improve methods for deriving functional cardiomyocytes from stem cells

  • Metabolic Cardiology:

    • The connection between ER stress and cardiac metabolism suggests REEP5 may influence metabolic adaptation

    • REEP5 could be involved in the cardiac response to metabolic diseases like diabetes

  • Systems Biology:

    • Integration of REEP5 into broader networks of cardiac stress response

    • Computational modeling of how REEP5-mediated structural changes affect cardiac function

  • Aging and Senescence:

    • Age-related changes in SR/ER function might involve alterations in REEP5 expression or function

    • REEP5 could be investigated as a factor in age-related cardiac dysfunction

By exploring these intersections, researchers may uncover novel insights into cardiac disease mechanisms and identify innovative approaches to cardiac protection and repair .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.