Recombinant Pongo abelii Relaxin receptor 1 (RXFP1)

Shipped with Ice Packs
In Stock

Description

Functional Characterization

  • Ligand Binding: Recombinant RXFP1 binds relaxin H2 with high affinity (EC₅₀ ≈ 50–94 nM) .

  • Signaling Pathways:

    • Activates cAMP via Gαs coupling, with EC₅₀ values ranging from 47 nM (small-molecule agonists) to 2 nM (relaxin) .

    • Secondary pathways include ERK1/2, p38MAPK, and nitric oxide (NO) cascades .

  • Dimerization: Forms homo- or heterodimers (e.g., with angiotensin receptors) to modulate signaling .

Table 2: Key Functional Data

Assay TypeResult (EC₅₀)System UsedReference
cAMP accumulation47 nM (compound 11)HEK293 cells
VEGF activation120% responseTHP1 cells
Ligand binding (SPR)K<sub>D</sub> = 5 nMInsect cell-expressed RXFP1

Applications in Biomedical Research

  1. Fibrosis Studies: Used to screen antifibrotic compounds by measuring collagen regulation .

  2. Cardiovascular Research: Evaluates vasodilation and blood pressure modulation via NO/cGMP pathways .

  3. Reproductive Biology: Analyzes roles in sperm motility, endometrial remodeling, and pregnancy .

  4. Drug Development: Facilitates high-throughput screening of RXFP1 agonists/antagonists .

Production Challenges and Optimization

  • Yield Improvements: Truncation of N-terminal LDLa/C-terminal residues (e.g., Δ1–82 or Δ708–757) increased expression 3-fold in insect cells .

  • Tag Positioning: N-terminal eGFP fusions reduced signaling activity by 80%, while C-terminal tags preserved function .

  • Glycosylation: Six putative glycosylation sites affect receptor trafficking but not ligand binding .

Limitations and Future Directions

  • Species-Specific Effects: Human vs. Pongo abelii RXFP1 may exhibit divergent signaling due to sequence variations .

  • Pathway Complexity: Multi-omics approaches are needed to map crosstalk with non-canonical pathways (e.g., tyrosine kinase) .

  • Structural Studies: Requires advanced cryo-EM or X-ray crystallography to resolve full-length receptor dynamics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate your need in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
RXFP1; Relaxin receptor 1; Relaxin family peptide receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-757
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MTSGSVFFYILIIGKYFSHGGGQDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADED NCGDNNGWSLQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCRGLELDCDETNLRA VPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKITSISIYAFRGLNSLTKLY LSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPPTFYGLNSLILLVLMNNVLTRLPDK PLCQHMPRLHWLDLEGNHIHNLRNLTLISCSNLTVLVMGKNKINHLNENTFAPLQKLDEL DLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNIQQ RMFRPLMNLSHIYFKKFQYCGYAPHVRSGKPNTDGISSLENLLASIIQRVFVWVVSAVTC FGNVFVICMRPYIRSENKLYAMSIISLCCADCLMGIYLFVIGGFDLKFRGEYNKHAQLWM ESTHCQLVGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCVRPGKCRTITVLILIWITGF IVAFIPLSNKEFFKNYYGTNGVCFPLHSEDTESIGAQVYSVAIFLGINLAAFIIIVFSYG SMFYSVHQSAITATEIRNQVKKEMILAKRFFFIVFTDALCWIPIFVVKFLSLLQVEIPGT ITSWVVIFILPINSALNPILYTLTTRPFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWV EMWPLQEMPPELMKPGLFTYPCEMSLISQSTRLNSYS
Uniprot No.

Target Background

Function
Relaxin receptor 1 (RXFP1) is a G protein-coupled receptor that serves as a receptor for relaxins. Its activation triggers a cascade of events, including stimulation of adenylate cyclase, leading to an increase in cAMP levels. Additionally, ligand binding may activate a tyrosine kinase pathway, which inhibits the activity of a phosphodiesterase responsible for degrading cAMP.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is RXFP1 and what are its key structural features?

RXFP1 (Relaxin Family Peptide Receptor 1), also known as LGR7 (Leucine-rich G-protein-coupled receptor 7), is a member of family C of the LGRs and serves as one of four receptors for Relaxin family proteins. This receptor belongs to the class A seven-transmembrane G-protein-coupled receptor (7TM GPCRs) superfamily based on sequence homology and functional similarity . Unlike classical peptide receptors with short N-terminal extracellular domains (like RXFP3 and RXFP4), RXFP1 contains a leucine-rich repeat (LRR) domain and a low-density lipoprotein class A (LDLa) module in its extracellular region . The LRR domain forms a shallow curvature structure with 10 LRRs that serves as the primary high-affinity relaxin binding site .

How does the structure of Pongo abelii RXFP1 likely compare to human RXFP1?

While specific sequence data for Pongo abelii RXFP1 is not detailed in the available literature, we can infer potential similarities based on comparative data with other species. Human RXFP1 shares considerable sequence identity with other mammalian species: 84% with mouse, 86% with rat, 85% with equine, 85% with bovine, and 91% with porcine RXFP1 . Given the close evolutionary relationship between humans and orangutans, Pongo abelii RXFP1 would likely exhibit higher sequence homology with human RXFP1 than other non-primate mammals, particularly in functionally critical domains like the LRR and LDLa modules that are essential for ligand binding and signaling.

What signaling pathways are associated with RXFP1 activation?

RXFP1 activation initiates multiple downstream signaling cascades. The receptor has been associated with cAMP, PI3K/Akt, NO/cGMP, MAPK, and ERK1/2 signaling pathways . When relaxin binds to RXFP1, it recruits G-proteins that activate adenylyl cyclase, resulting in elevated cAMP levels . This can lead to a cAMP/protein kinase A-dependent mechanism that may promote NOS2 (iNOS) expression and nitric oxide (NO) production . Additionally, relaxin/RXFP1 can activate PI3K/Akt-associated signaling pathways, which contribute to vasodilation in the cardiovascular system and regulate cell differentiation . Researchers studying Pongo abelii RXFP1 should investigate whether these pathways are conserved across species and any potential differences in signaling efficiency or alternative pathway activation.

What physiological roles does RXFP1 play in mammals?

RXFP1 mediates numerous physiological processes through relaxin signaling. These include development of mammary nipples and vaginal epithelium (demonstrated in mice), cervix growth during pregnancy (in rats and pigs), growth of vagina and uterus during pregnancy (in pigs), new blood vessel formation and endometrial connective tissue maintenance in early pregnancy (in rhesus monkeys), and improvement of spermatozoan motility . Perhaps most significantly, RXFP1 activation has demonstrated potent antifibrotic effects by relaxing collagen fibers in multiple tissues . While these functions have been established in various species, specific roles in Pongo abelii would require dedicated investigation to confirm conservation or identify species-specific adaptations.

How might alternative splicing of Pongo abelii RXFP1 affect receptor function?

Alternative splicing of RXFP1 has been observed in humans with potential functional consequences in disease tissues . Human RXFP1 has multiple isoforms, including forms of 724 and 709 amino acids that lack amino acids 63-96 and 300-348, respectively, as well as truncated isoforms of 176, 189, 191, and 337 amino acids that diverge after amino acids 154, 179, 181, and 324 . These truncated forms may dimerize with full-length RXFP1 and reduce its expression on the cell surface .

For researchers studying Pongo abelii RXFP1, it would be crucial to determine if similar alternative splicing occurs and how it might affect receptor function. Methodologically, this would involve RNA sequencing from various orangutan tissues, followed by PCR validation of specific splice variants. Functional studies using co-expression of identified splice variants with full-length receptors would help determine if these variants also act as dominant negatives, as seen in humans.

What are the implications of RXFP1 homo/heterodimerization for Pongo abelii models?

Receptor dimerization plays an important role in relaxin/RXFP1 signaling . In humans, RXFP1 can form homodimers and potentially heterodimers with other receptors, which may alter signaling outcomes . For Pongo abelii RXFP1 research, investigating potential dimerization partners would be important, particularly to understand species-specific signaling patterns.

Methodologically, researchers should employ techniques such as bioluminescence resonance energy transfer (BRET), fluorescence resonance energy transfer (FRET), or co-immunoprecipitation to identify potential dimerization patterns. Cross-species comparison studies would help determine if dimerization patterns and their functional consequences are conserved between humans and orangutans.

How might reduced RXFP1 expression in fibrotic tissues impact therapeutic approaches using recombinant relaxin?

Clinical trials using relaxin-based therapy failed in patients with systemic sclerosis despite strong preclinical evidence supporting relaxin as a potent antifibrotic molecule . Reduced RXFP1 expression in fibrotic tissues, particularly in lung and skin, may explain the insensitivity to exogenous relaxin treatments .

For researchers working with Pongo abelii models of fibrosis, this raises important questions about receptor expression levels and therapeutic efficacy. Methodologically, researchers should quantify RXFP1 expression in normal versus fibrotic orangutan tissues using qPCR and immunohistochemistry techniques. Further, testing interventions aimed at upregulating RXFP1 expression prior to relaxin treatment might enhance therapeutic efficacy. Comparative studies between human and orangutan fibrotic models could provide insights into evolutionary conservation of fibrotic mechanisms and potential species-specific therapeutic approaches.

What epigenetic mechanisms might regulate Pongo abelii RXFP1 expression?

Understanding the epigenetic regulation of RXFP1 is crucial for addressing the reduced expression observed in fibrotic conditions. Though not explicitly detailed in the search results, epigenetic mechanisms like DNA methylation, histone modifications, and non-coding RNAs likely play roles in regulating RXFP1 expression.

For Pongo abelii RXFP1 researchers, methodological approaches should include bisulfite sequencing to analyze promoter methylation patterns, ChIP-seq to investigate histone modifications at the RXFP1 locus, and RNA-seq to identify potential regulatory non-coding RNAs. Cross-species comparative epigenetic analyses between human and orangutan RXFP1 would provide insights into conserved regulatory mechanisms and potentially identify novel targets for therapeutic intervention to restore RXFP1 expression in disease states.

What are the optimal expression systems for producing functional recombinant Pongo abelii RXFP1?

For functional studies of Pongo abelii RXFP1, selecting an appropriate expression system is critical. Based on human RXFP1 research, mammalian expression systems likely offer the best environment for proper protein folding, post-translational modifications, and trafficking of this complex receptor. Human embryonic kidney (HEK293) cells have been successfully used for human RXFP1 and would likely be suitable for orangutan RXFP1 as well.

For protein production, researchers should consider using a construct that includes an N-terminal signal peptide to ensure proper membrane targeting, followed by an affinity tag (such as His-tag or Fc fusion) for purification purposes. As seen with the human RXFP1 Fc chimera protein, the extracellular domain (ECD) from Gln23 to Ser398 can be expressed as a soluble protein . Researchers should design constructs that maintain the integrity of the LDLa domain and LRR repeats which are essential for ligand binding and signal transduction.

How should binding assays be designed to assess ligand interactions with Pongo abelii RXFP1?

For characterizing ligand interactions with recombinant Pongo abelii RXFP1, several complementary binding assay approaches should be considered:

  • Competition binding assays using radiolabeled human relaxin-2 to determine if Pongo abelii RXFP1 can bind human relaxin-2 and to establish binding affinities.

  • Surface plasmon resonance (SPR) with the recombinant extracellular domain to determine binding kinetics (kon and koff rates).

  • BRET-based assays for studying ligand-induced conformational changes in the full-length receptor in a cellular context.

Researchers should test binding of both human relaxin-2 and, if available, Pongo abelii relaxin-2 to determine if there are species-specific differences in ligand recognition. Cross-species binding studies would provide valuable insights into the evolutionary conservation of the relaxin signaling system among primates.

What functional assays are most appropriate for evaluating Pongo abelii RXFP1 signaling?

Based on known RXFP1 signaling pathways, several functional assays would be appropriate for evaluating Pongo abelii RXFP1:

  • cAMP accumulation assays to measure G-protein activation

  • Phospho-ERK and phospho-Akt assays to assess MAPK and PI3K pathway activation

  • Nitric oxide (NO) production assays

  • Reporter gene assays using cAMP-responsive elements (CRE)

  • Calcium mobilization assays

  • β-arrestin recruitment assays to assess receptor desensitization

A comprehensive characterization would include dose-response curves for different ligands and time-course experiments to capture the temporal dynamics of signaling. Comparison with human RXFP1 signaling responses in parallel experiments would identify any species-specific signaling characteristics.

How can alternative splicing of Pongo abelii RXFP1 be systematically investigated?

To systematically investigate alternative splicing of Pongo abelii RXFP1, researchers should:

  • Perform RNA-seq on multiple orangutan tissues with different physiological states (normal vs. disease conditions)

  • Design PCR primers that span potential splice junctions, informed by human RXFP1 splice variants

  • Use rapid amplification of cDNA ends (RACE) to identify novel splice variants

  • Clone and sequence all identified variants for confirmation

  • Express recombinant splice variants to assess their functionality and potential dominant-negative effects

A particular focus should be placed on tissues known to express high levels of RXFP1 in humans, such as reproductive tissues, heart, and tissues prone to fibrosis like lung and skin.

How conserved is RXFP1 across primate species and what are the implications for translational research?

Human RXFP1 shows varying degrees of sequence identity with other mammalian species (84-91%) , but specific data on orangutan RXFP1 homology was not provided in the search results. For researchers investigating evolutionary aspects, a thorough phylogenetic analysis of RXFP1 across primates would be valuable.

Methodologically, researchers should perform sequence alignments of RXFP1 from various primate species, with particular focus on functional domains like the LRR and LDLa modules. Conservation analysis using tools like ConSurf would identify residues under evolutionary pressure. Homology modeling of Pongo abelii RXFP1 based on human RXFP1 structural data would help visualize potential species-specific differences in binding interfaces.

The degree of conservation has direct implications for translational research—higher conservation suggests human findings may be more applicable to orangutan models, while regions of divergence might explain species-specific responses to relaxin or therapeutic interventions.

What are the species-specific differences in relaxin binding to RXFP1 between humans and Pongo abelii?

Understanding species-specific differences in relaxin binding requires detailed binding studies. Human relaxin-2 has been shown to be the primary ligand for human RXFP1, with the LRR domain serving as the primary high-affinity binding site .

For comparative research, scientists should express the recombinant extracellular domain of both human and Pongo abelii RXFP1 and perform parallel binding studies with relaxin-2 from both species. Techniques such as isothermal titration calorimetry (ITC) and surface plasmon resonance (SPR) would provide detailed thermodynamic and kinetic parameters of these interactions. Mutational studies focusing on non-conserved residues in the binding interface would identify key determinants of species-specific binding characteristics.

What emerging technologies might advance Pongo abelii RXFP1 research?

Several emerging technologies hold promise for advancing Pongo abelii RXFP1 research:

  • Cryo-EM for structural determination of the full-length receptor in complex with ligands and signaling partners

  • CRISPR-Cas9 gene editing to create precise mutations or humanized variants in cell models

  • Single-cell RNA sequencing to map RXFP1 expression across diverse cell populations

  • Organ-on-chip technologies for studying RXFP1 function in physiologically relevant microenvironments

  • Advanced computational approaches for predicting species-specific ligand-receptor interactions

These technologies would enable more detailed characterization of receptor structure, function, and signaling in physiologically relevant contexts.

What are the key unanswered questions about Pongo abelii RXFP1 that warrant future research?

Based on the current understanding of RXFP1 biology, several key questions about Pongo abelii RXFP1 warrant further investigation:

  • Are the alternative splicing patterns of RXFP1 conserved between humans and orangutans, and do they serve similar regulatory functions?

  • How does the expression of RXFP1 in fibrotic tissues compare between humans and orangutans, and could this explain potential differences in response to relaxin therapy?

  • What are the species-specific differences in RXFP1 dimerization patterns and how do these impact signaling outcomes?

  • How have evolutionary pressures shaped RXFP1 function in different primate lineages?

  • Could differences in RXFP1 signaling explain species-specific physiological traits related to reproduction, cardiovascular function, or tissue remodeling?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.