Recombinant Pongo abelii RING finger and transmembrane domain-containing protein 2 (RNFT2)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant RNFT2 is generated via heterologous expression in E. coli followed by affinity chromatography (Ni-NTA) leveraging its N-terminal His-tag .

Functional Roles

RNFT2 is implicated in:

  • Ubiquitination Pathways: Acts as an E3 ubiquitin ligase, targeting substrates like IL3RA for proteasomal degradation to modulate immune responses .

  • Membrane Trafficking: Its transmembrane domain suggests roles in vesicular transport or receptor internalization .

  • Zinc Ion Binding: The RING domain coordinates zinc ions essential for structural stability .

Key Functional Partners

Interacting Protein/MoleculeRole in Pathway
ESR2Direct interaction detected via yeast two-hybrid assays
IL3RASubstrate for ubiquitination and degradation

Research Applications

Recombinant RNFT2 is used in:

  • ELISA and Immunoassays: Commercial kits utilize this protein for antibody validation .

  • Protein Interaction Studies: Screening for binding partners (e.g., ESR2) .

  • Structural Biology: Analysis of RING finger domain mechanics .

Evolutionary Conservation

RNFT2 orthologs are present across eukaryotes, including plants (Vitis vinifera) and mammals. Key ortholog groups include:

SpeciesProtein IDIdentity (%)Functional Similarity
Pongo abeliiQ5RAG4100Ubiquitination, zinc binding
Vitis viniferaF6GU7063RING domain conservation
Spinacia oleraceaA0A0K9RRL955Transmembrane domain homology

Data from InParanoidDB highlights conserved residues in the RING and transmembrane regions .

Technical Considerations

  • Activity Assays: Requires reconstitution in reducing buffers to maintain zinc-binding capacity .

  • Limitations: Lack of post-translational modifications in prokaryotic systems may affect functional studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. We recommend consulting your local distributors for specific delivery timelines.
Note: Our proteins are routinely shipped with standard blue ice packs. If dry ice shipping is preferred, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, and customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We prioritize the tag type determined during production. However, if you have a specific tag requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
RNFT2; TMEM118; RING finger and transmembrane domain-containing protein 2; Transmembrane protein 118
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
RNFT2
Target Protein Sequence
MWLFTVNQVLRKMQRRHSSNTDNIPPERNRSQALSSEASVDEGGVFESLKAEAASPPALF SGLSGSLPTSSFPSSLVLGSSAGGGDVFIQMPASREEGGGRGEGGAYHHRQPHHHFHHGG HRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGLPFILILLAKLCFQ HKLGIAVCIGMASTFAYANSTLREQVSLKEKRSVLVILWILAFLAGNTLYVLYTFSSQQL YNSLIFLKPNLETLDFFDLLWIVGIADFVLKYITIALKCLIVALPKIILAVKSKGKFYLV IEELSQLFRSLVPIQLWYKYIMGDDSSNSYFLGGVLIVLYSLCKSFDICGRVGGVRKALK LLCTSQNYGVRATGQQCTEAGDICAICQAEFREPLILLCQHVFCEECLCLWLDRERTCPL SRSVAVDTLRCWKDGATSAHFQVY
Uniprot No.

Target Background

Database Links

KEGG: pon:100174460

UniGene: Pab.2881

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does recombinant Pongo abelii RNFT2 compare structurally with mouse and human orthologs?

Comparing the recombinant RNFT2 proteins from different species reveals high conservation, particularly in functional domains:

SpeciesProtein LengthUniProt IDKey Conserved DomainsSimilarity to Human RNFT2
Pongo abelii444 aaQ5RAG4RING finger, Transmembrane>95%
Mus musculus445 aaQ3UF64RING finger, Transmembrane>90%
Homo sapiens444 aaQ6ZVN8RING finger, TransmembraneReference

The high degree of conservation suggests functional importance across species, with the RING finger domain being particularly well-preserved as it is essential for E3 ligase activity. Multiple sequence alignment shows that critical residues in the RING domain responsible for zinc coordination and substrate interaction are nearly identical between species .

What are the optimal expression systems for recombinant Pongo abelii RNFT2 production?

Bacterial expression in E. coli has been successfully employed for recombinant RNFT2 production. The recommended protocol involves:

  • Expression of the full-length RNFT2 (1-444aa) with an N-terminal His-tag in E. coli

  • Cultivation at optimal temperature (typically 16-25°C post-induction) to enhance proper folding

  • Extraction using appropriate lysis buffers containing protease inhibitors

  • Purification via nickel affinity chromatography

The purified protein has shown greater than 90% purity as determined by SDS-PAGE analysis . For transmembrane proteins like RNFT2, careful optimization of detergent conditions during purification is critical to maintain native conformation.

What are the critical factors to consider when reconstituting lyophilized RNFT2 protein?

When reconstituting lyophilized RNFT2 protein, researchers should follow these methodological steps:

  • Brief centrifugation before opening to bring contents to the bottom of the vial

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol to a final concentration of 5-50% (recommended 50%) for long-term storage stability

  • Aliquoting for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles

Working aliquots may be stored at 4°C for up to one week, but repeated freezing and thawing is not recommended as it may compromise protein integrity and biological activity .

What is the role of RNFT2 in interleukin signaling pathways?

RNFT2 serves as a key regulator of IL-3 signaling through its E3 ligase activity targeting IL-3Rα. Experimental evidence indicates:

  • RNFT2 directly interacts with IL-3Rα, as demonstrated by pull-down assays

  • RNFT2 mediates the ubiquitination of IL-3Rα, targeting it for degradation

  • RNFT2 expression leads to dose-dependent decreases in IL-3Rα protein levels without affecting IL-3Rβ

  • RNFT2 overexpression enhances IL-3-induced IL-3Rα degradation

Notably, the RING domain of RNFT2 is essential for this function, as mutation of critical residues within this region preserves IL-3Rα protein levels. This regulatory mechanism has significant implications for innate immunity, as IL-3 signaling plays a crucial role in inflammatory responses .

How does RNFT2 regulate inflammatory responses through the IL-3 pathway?

RNFT2 influences inflammatory responses through several mechanisms:

  • Regulation of IL-3Rα stability and consequently IL-3 signaling

  • Modulation of TRAF6 protein levels in response to IL-3 stimulation:

    • RNFT2 overexpression decreases TRAF6 protein in IL-3-stimulated cells

    • RNFT2 knockdown significantly increases TRAF6 protein abundance

  • Impact on inflammatory cytokine production:

    • RNFT2 overexpression reduces IL-6 and CXCL1 cytokine secretion in cells with wild-type IL-3Rα

    • This effect is lost in cells expressing the degradation-resistant K357R IL-3Rα mutant

These findings suggest that RNFT2 serves as a negative regulator of inflammatory responses by controlling IL-3Rα stability and downstream signaling events .

What are the implications of RNFT2 in cancer biology and potential therapeutic applications?

Recent research has revealed significant implications for RNFT2 in cancer biology, particularly in gastric cancer (GC):

  • Expression profile:

    • RNFT2 is significantly upregulated in GC tissues and cell lines

    • High RNFT2 expression correlates with poor prognosis in GC patients

  • Functional impact:

    • Knockdown of RNFT2 in GC cells inhibits:

      • Cell proliferation

      • Invasion

      • Migration

    • In vivo experiments demonstrate that silencing RNFT2 expression significantly reduces tumor size

  • Molecular mechanism:

    • RNFT2 influences GC progression through the mTORC1 signaling pathway

    • Gene set enrichment analysis (GSEA) and immunoblotting studies support this mechanistic link

These findings suggest that RNFT2 could serve as both a prognostic marker and a potential therapeutic target in GC treatment strategies .

How can CRISPR-Cas9 technology be optimized for RNFT2 functional studies?

For optimal CRISPR-Cas9-based functional studies of RNFT2:

  • Design considerations:

    • Target conserved regions within the RING domain to disrupt E3 ligase function

    • For complete knockout, target early exons to create frameshift mutations

    • Include appropriate controls (non-targeting gRNAs) to account for off-target effects

  • Validation strategies:

    • Confirm gene editing efficiency using:

      • T7 endonuclease assay or Sanger sequencing

      • Western blot verification of protein depletion

      • RT-qPCR validation of transcript levels

  • Functional assessment:

    • Based on known RNFT2 functions, evaluate:

      • Changes in IL-3Rα stability and ubiquitination

      • Alterations in inflammatory responses

      • Cell proliferation, invasion, and migration in cancer models

      • Signaling pathway activation (particularly mTORC1 signaling)

When designing shRNA for RNFT2 knockdown experiments, follow protocols as described in recent literature, including puromycin selection for establishing stable cell lines .

What are the optimal conditions for in vitro ubiquitination assays with recombinant RNFT2?

For successful in vitro ubiquitination assays with RNFT2:

  • Required components:

    • Purified recombinant RNFT2 protein

    • Target substrate (e.g., purified IL-3Rα)

    • Complete ubiquitination machinery:

      • E1 (ubiquitin-activating enzyme)

      • E2 (ubiquitin-conjugating enzyme)

      • Ubiquitin

      • ATP and Mg²⁺

  • Reaction conditions:

    • Buffer composition: Typically Tris-HCl (pH 7.5), containing NaCl, MgCl₂, DTT, and ATP

    • Temperature and duration: 30-37°C for 1-2 hours

    • Controls: Omission of individual components to confirm specificity

  • Detection methods:

    • Western blotting using antibodies against the target protein or ubiquitin

    • Mass spectrometry to identify specific ubiquitination sites

Previous studies have demonstrated that RNFT2 protein, in combination with the full complement of ubiquitination machinery, is sufficient to ubiquitinate IL-3Rα in vitro .

How can researchers troubleshoot low expression yields of recombinant RNFT2?

When facing low expression yields of recombinant RNFT2:

  • Expression vector optimization:

    • Codon optimization for the expression host

    • Use of solubility-enhancing fusion tags (SUMO, MBP, or TRX)

    • Evaluation of different promoter systems

  • Expression conditions:

    • Reduce induction temperature (16-20°C)

    • Decrease IPTG concentration (0.1-0.5 mM)

    • Extend expression time (overnight to 24 hours)

    • Test different E. coli strains (BL21(DE3), Rosetta, Arctic Express)

  • Protein extraction and purification:

    • Optimize lysis buffer composition:

      • Include appropriate detergents for transmembrane proteins

      • Add protein stabilizers (glycerol, reducing agents)

    • Try different cell disruption methods

    • Increase imidazole concentration in wash buffers to reduce non-specific binding

  • Storage and stability:

    • Maintain protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Add glycerol to a final concentration of 50% for long-term storage

How does the E3 ligase activity of RNFT2 compare with other RING finger domain-containing proteins?

The E3 ligase activity of RNFT2 demonstrates both similarities and unique features compared to other RING finger domain-containing proteins:

E3 LigaseTarget Substrate(s)Signaling PathwayFunctional Outcome
RNFT2IL-3RαIL-3/TRAF6Regulation of inflammatory responses
RNF43Wnt receptorsWnt signalingControl of cell proliferation
c-CBLRTKs (e.g., EGFR)Growth factor signalingReceptor downregulation
TRAF6Self/targetsNF-κBImmune activation

While many RING E3 ligases target receptors for degradation to attenuate signaling, RNFT2's specific role in targeting IL-3Rα positions it as a unique regulator of inflammatory responses through control of cytokine receptor stability .

What evolutionary insights can be gained from comparing RNFT2 sequences across primate species?

Comparative analysis of RNFT2 across primate species reveals:

  • High conservation of the RING finger domain, suggesting critical functional importance

  • More variation in transmembrane regions, possibly reflecting adaptation to different cellular environments

  • Conserved ubiquitination sites, particularly K357 in IL-3Rα, which is the target of RNFT2 E3 ligase activity

The evolutionary conservation pattern supports the hypothesis that RNFT2's role in immune regulation through IL-3Rα modification is an ancient and essential mechanism. Specific amino acid substitutions between species may reflect adaptation to species-specific pathogens or inflammatory challenges .

How does RNFT2 interact with the mTORC1 signaling pathway in cancer progression?

The interaction between RNFT2 and the mTORC1 signaling pathway in cancer progression reveals a complex regulatory network:

  • Signaling cascades:

    • RNFT2 influences mTORC1 signaling components as demonstrated through GSEA and immunoblotting studies

    • Specifically, RNFT2 affects the phosphorylation status of key downstream targets:

      • p-S6K (phosphorylated ribosomal protein S6 kinase)

      • p-S6 (phosphorylated ribosomal protein S6)

  • Functional outcomes:

    • Enhanced mTORC1 signaling contributes to:

      • Increased cell proliferation

      • Augmented migration and invasion potential

      • Tumor growth in vivo

  • Potential mechanism:

    • RNFT2 may regulate the stability or activity of upstream regulators of mTORC1

    • Alternatively, RNFT2 could directly ubiquitinate components of the mTORC1 pathway

    • This modulation alters signaling intensity and duration, promoting malignant phenotypes

These findings provide a mechanistic basis for RNFT2's role in gastric cancer progression and suggest that targeting the RNFT2-mTORC1 axis could have therapeutic potential in cancer treatment .

What experimental approaches can elucidate the substrate specificity of RNFT2 beyond known targets?

To identify novel RNFT2 substrates beyond IL-3Rα:

  • Proteomic approaches:

    • Quantitative proteomics comparing protein levels in RNFT2 knockout vs. wild-type cells

    • Ubiquitinome analysis using di-glycine remnant profiling

    • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to RNFT2

  • Biochemical methods:

    • Co-immunoprecipitation coupled with mass spectrometry

    • In vitro ubiquitination screens using protein arrays

    • Yeast two-hybrid screening to identify direct interacting partners

  • Computational prediction:

    • Analysis of proteins containing conserved motifs similar to those in IL-3Rα

    • Machine learning approaches using known E3 ligase-substrate pairs

    • Structural modeling of RING domain-substrate interactions

  • Validation strategies:

    • Direct binding assays with recombinant proteins

    • Ubiquitination assays with candidate substrates

    • Functional studies examining the effect of RNFT2 on candidate stability

These complementary approaches would provide a comprehensive view of RNFT2's substrate specificity and expand our understanding of its biological functions .

What are the potential applications of RNFT2 as a therapeutic target in inflammatory diseases?

Given RNFT2's role in regulating IL-3Rα and inflammatory responses, several therapeutic strategies could be explored:

  • Small molecule inhibitors:

    • Development of compounds targeting the RING domain to inhibit E3 ligase activity

    • Structure-based drug design leveraging crystallographic data of RNFT2

    • High-throughput screening for molecules that disrupt RNFT2-IL-3Rα interaction

  • Peptide-based therapeutics:

    • Design of peptides mimicking critical interaction interfaces

    • Cell-penetrating peptides that interfere with RNFT2 function

    • Stapled peptides for enhanced stability and cell penetration

  • Target indications:

    • Inflammatory lung conditions where IL-3 signaling plays a key role

    • Asthma and allergic inflammation

    • Autoimmune disorders with dysregulated cytokine signaling

  • Combination approaches:

    • RNFT2 inhibitors with existing anti-inflammatory agents

    • Dual targeting of IL-3 pathway components

    • Personalized approaches based on RNFT2 expression levels

Future research should focus on validating these approaches in relevant disease models and addressing potential off-target effects given RNFT2's role in multiple cellular processes .

How might advanced structural biology techniques enhance our understanding of RNFT2 function?

Advanced structural biology techniques could significantly advance our understanding of RNFT2:

  • Cryo-electron microscopy (cryo-EM):

    • Determination of full-length RNFT2 structure, including transmembrane domains

    • Visualization of RNFT2 in complex with IL-3Rα and ubiquitination machinery

    • Structural analysis of different conformational states during the ubiquitination cycle

  • X-ray crystallography:

    • High-resolution structures of the RING domain in isolation

    • Co-crystals with E2 conjugating enzymes

    • Structures of RNFT2 bound to small molecule inhibitors

  • NMR spectroscopy:

    • Dynamic studies of RNFT2 during substrate binding

    • Characterization of flexible regions not resolved by other methods

    • Investigation of conformational changes upon posttranslational modifications

  • Integrative structural biology:

    • Combining multiple techniques (crosslinking mass spectrometry, SAXS, etc.)

    • Computational modeling and simulation

    • In-cell structural studies using advanced fluorescence techniques

These approaches would provide critical insights into how RNFT2 recognizes its substrates, interacts with the ubiquitination machinery, and changes conformation during its catalytic cycle, potentially informing therapeutic development efforts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.