Recombinant Pongo abelii Schlafen family member 12-like (SLFN12L)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pongo abelii Schlafen Family Member 12-Like (SLFN12L)

The SLFN12L gene encodes for Schlafen Family Member 12 Like protein . The Schlafen family proteins, including SLFN12L, are believed to play a role in regulating cell growth and differentiation . Some, like SLFN12, can act as HIV-1 restriction factors by establishing a post-transcriptional block in HIV-1-infected cells .

SLFN12L and its Role in HIV-1 Inhibition

SLFN12, a protein of the Schlafen family, has been identified as an HIV-1 restriction factor that can block HIV-1 in infected cells post-transcriptionally .

Key findings regarding SLFN12's role in HIV-1 inhibition :

  • SLFN12 expression correlates with HIV-1 plasma viral loads and proviral loads.

  • SLFN12 expression is enriched in infected cells that are positive for HIV-1 transcripts but negative for HIV-1 proteins.

  • SLFN12 controls HIV-1 reactivation from latently infected T cells by repressing the translation efficiency of Gag-Pr55.

  • The attenuation of HIV-1 protein production by SLFN12 is codon-usage dependent.

Codon Usage and Translation Inhibition

HIV-1 uses many A-ending codons that are rare in humans, including Leu-UUA, instead of Leu-CUG, which is common in humans . When Leu codon swapping within EGFP was performed, SLFN12 inhibited only Leu-UUA swapped EGFP, demonstrating that the attenuation of HIV-1 protein production by SLFN12 is codon-usage dependent .

SLFN Family in Malignant Tumors

Research indicates a significant correlation between elevated SLFN11 levels and the susceptibility of cancer cells . The SLFN family members have roles in cancer, including:

Proposed Mechanism
SLFN5 Prevention of epithelial-mesenchymal transition (EMT) in breast cancer Is inversely associated with tumor growth in human BRCA Inhibition of HIV-1 transcription by epigenetics New therapeutic targets for pancreatic cancer Enhance the malignant degree of glioblastoma Reduce lung damage in pneumonia
SLFN11 Inhibit HIV-1 virus replication It is expected to be a biological marker for lung cancer and liver cancer Increased sensitivity to chemotherapy
SLFN12 To improve the efficacy of radiotherapy and chemotherapy for triple-negative breast cancer Improve the prognosis of lung adenocarcinoma and identify it as a therapeutic target
SLFN13 Increase the body's resistance to HIV-1 Improve the ability to resist glioblastoma

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
SLFN12L; Schlafen family member 12-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-619
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
SLFN12L
Target Protein Sequence
MQLSEGLAAHGTRRAGKWKRTQVPLLGEECADMDLARKEFLLGNGLAAGKMNISIDLDTN YAELVLNVGRVTLGENNRRKMKDSQLRKQQNENVSRAVCALLNSGGGFIKAEVENEDYSY KKDGIGLDLENSFSNMLPFVPNFLDFMQNGNYFHIFVKSWSLETSGPQIATLSSSLYKRD VTSAKVMNASAALEFLKDMEKTGGRAYLRPESPAKRACVDVQEESNMEALAADFFNRTEL NYKEKLTFTESTHVEIKNFATEKLLQRITEILPQYVSAFANTDGGYLFVGLNEDKEIIGF KAEKSYLTKLEEVTKNSIGKLPVHHFCVEKGTINYLCKSLGVYDKGRLCGYVYALRVERF CCAVFAKKPDSWHVKDNRVKQLTEKEWIQFMVDSESVCEELPSPASTSSPVSQSCPLCEY INFKIQPLRYHLPGLSEKITFAPKTLCRNLFSQHEGLKQLICEEMGSVSKGSLIFSRSWS LDLGLQENHKVLCDALLISQDKPPVLYTFHMVQDEEFKGYSTQTAQTLKQKLAKIGGYTK KVCVMTKIFYLSPEGKTSCQYDLNSQVIYPESYYWTTAQTMKDLEKALSNILPKENQIFL FVCLFRFCLFVCLFVFFLR
Uniprot No.

Target Background

Database Links

KEGG: pon:100190853

UniGene: Pab.19823

Protein Families
Schlafen family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What domains are present in SLFN12L and what are their predicted functions?

SLFN12L contains several key domains that contribute to its function:

  • N-terminal domain: Involved in protein-protein interactions and regulatory functions.

  • Middle (M) domain: Contains the core region responsible for nucleic acid interactions and potential enzymatic activity.

  • Putative zinc finger motif: Present on the backside valley, similar to what has been identified in SLFN5, SLFN12, and rSlfn13, suggesting a role in nucleic acid binding .

The zinc finger motif is particularly significant as it is conserved across human and mouse SLFNs, indicating that nucleotide-binding capacity is a fundamental feature of Schlafen proteins . While SLFN12L lacks the C-terminal helicase domain of Group III SLFNs, its structural similarity to SLFN12 suggests it may function through partnering with other proteins to compensate for this missing domain .

What are the optimal storage and handling conditions for recombinant SLFN12L?

For optimal stability and activity of recombinant Pongo abelii SLFN12L:

  • Long-term storage: Store at -20°C or -80°C for extended preservation .

  • Working aliquots: Store at 4°C for up to one week .

  • Buffer composition: Tris-based buffer with 50% glycerol, optimized for protein stability .

  • Avoid freeze-thaw cycles: Repeated freezing and thawing is not recommended as it may compromise protein integrity .

When designing experiments with SLFN12L, researchers should consider making small working aliquots to minimize freeze-thaw cycles and maintain protein activity throughout the experimental period.

What analytical methods are most effective for studying SLFN12L's molecular interactions?

Based on successful approaches with related Schlafen proteins, the following methods are recommended for studying SLFN12L:

  • Cryo-electron microscopy: Effective for structural analysis of SLFN protein complexes, as demonstrated with the PDE3A-SLFN12 complex .

  • Co-immunoprecipitation assays: Valuable for identifying protein-protein interactions, particularly important given that SLFN12L, like SLFN12, may function through interactions with partner proteins .

  • RNA binding and cleavage assays: To investigate potential RNase activity and substrate specificity, similar to studies on other SLFNs .

  • Subcellular localization studies: Immunocytochemistry/IF analysis to determine cellular distribution patterns .

  • Protein expression profiling: Techniques like western blotting and ELISA to quantify expression levels in different tissues and under various conditions.

What is currently understood about SLFN12L's role in cellular processes?

Current research indicates that SLFN12L is associated with cellular transformation processes, particularly in the context of Helicobacter infection and gastric cancer development . Its expression has been linked to the transition of preneoplastic cells to gastric cancer cells during Helicobacter infection , suggesting a role in cancer progression.

How does SLFN12L potentially differ functionally from its close relative SLFN12?

While SLFN12L shares structural features with SLFN12, important functional differences may exist:

FeatureSLFN12SLFN12L
Group classificationGroup II SLFNGroup II SLFN
Key interactionsForms complex with PDE3ANot definitively established
Role in cancerAssociated with favorable outcomes in lung, prostate, and breast cancersAssociated with gastric cancer progression during Helicobacter infection
Therapeutic relevanceTarget for PDE3 inhibitorsPotential role in cancer progression, but therapeutic applications not yet established
RNase activityCleaves rRNA as part of PDE3A complexUnknown if exhibits similar nuclease activity

SLFN12 has been well-characterized for its interaction with phosphodiesterase 3A (PDE3A), forming a complex that enhances RNase activity and induces apoptotic cell death in cancer cells . This interaction is enhanced by various chemical modulators including 17-β-estradiol, anagrelide, nauclefine, and DNMDP .

In contrast, SLFN12L's functional partners and molecular mechanisms remain less defined, though its association with gastric cancer development suggests distinct biological roles that warrant further investigation .

What is the evidence for SLFN12L's involvement in cancer progression?

The primary evidence for SLFN12L's role in cancer comes from studies showing its association with the transition of preneoplastic cells to gastric cancer cells during Helicobacter infection . Specifically:

  • SLFN12L expression changes have been observed during the progression from normal gastric tissue to preneoplastic lesions and ultimately to gastric cancer in the context of Helicobacter infection .

  • While the exact mechanistic details remain to be fully elucidated, this association suggests SLFN12L may influence cellular transformation pathways that contribute to carcinogenesis.

  • Unlike SLFN12, which is associated with favorable outcomes in several cancer types (lung, prostate, and breast), SLFN12L appears to be linked to progression rather than suppression of cancer, specifically in gastric cancer contexts .

This contrasting role highlights the functional divergence within the Schlafen family despite structural similarities, underscoring the need for protein-specific investigation rather than extrapolation of functions between family members.

How might SLFN12L contribute to gastric cancer development during Helicobacter infection?

While the exact molecular mechanisms remain under investigation, several hypotheses can be proposed based on the known functions of related Schlafen proteins:

  • RNA metabolism alterations: Other Schlafen proteins (SLFN11, SLFN13, SLFN14) exhibit endoribonuclease activity against various RNA species . SLFN12L might similarly affect specific RNA populations crucial for cellular transformation.

  • Translational regulation: SLFN12L could influence protein synthesis patterns through direct or indirect effects on translation machinery, similar to how SLFN12-PDE3A complexes affect protein translation .

  • Immune response modulation: Helicobacter infection triggers inflammatory responses, and SLFN12L might influence these pathways, potentially affecting the balance between anti-tumor immunity and cancer-promoting inflammation.

  • Cellular stress responses: SLFN12L could participate in cellular responses to bacterial infection-induced stress, potentially altering cell fate decisions between survival, senescence, and transformation.

Methodological approaches to investigate these possibilities would include:

  • Gene knockout and overexpression studies in gastric cell lines

  • Proteomics analyses to identify SLFN12L interaction partners

  • RNA-seq to determine effects on transcriptome

  • In vitro and in vivo models of Helicobacter infection with manipulation of SLFN12L expression

How does SLFN12L relate evolutionarily to other Schlafen proteins?

The Schlafen family exhibits significant evolutionary conservation while maintaining functional divergence. SLFN12L represents an interesting case study within this family:

  • SLFN12L belongs to Group II Schlafens, which are characterized by the presence of N-terminal and middle domains but absence of the C-terminal helicase domain found in Group III members .

  • The putative zinc finger motif identified in SLFN12L is conserved across human and mouse Schlafen proteins, suggesting evolutionary importance for nucleic acid binding functions .

  • As a Pongo abelii (Sumatran orangutan) protein, SLFN12L provides insights into the evolution of Schlafen proteins in non-human primates, potentially revealing evolutionary adaptations in this protein family.

  • The functional divergence observed between SLFN12 and SLFN12L, despite structural similarities, exemplifies how Schlafen proteins have "evolutionally adapted according to their environments" , developing specialized functions while maintaining core structural elements.

What structural features might determine SLFN12L's substrate specificity?

Based on studies of other Schlafen family members, several structural features likely influence SLFN12L's substrate specificity:

  • Active site configuration: The active sites of different SLFNs show varying characteristics. For example, mouse Slfn2's active site is positively charged, correlating with its function in shielding tRNAs from cleavage during oxidative stress, while SLFN5's conserved active site lacks endoribonuclease activity against tRNAs despite conservation .

  • Zinc finger motif: This conserved feature found in SLFN12L, SLFN5, SLFN12, and rSlfn13 likely contributes to nucleic acid target recognition and may influence substrate specificity .

  • N-terminal domain variations: Differences in this region between Schlafen family members may contribute to their distinct functional roles and interaction partners.

Analyzing these structural elements in SLFN12L could provide insights into its potential substrates and molecular functions, particularly in comparison to the better-characterized SLFN12 protein.

What experimental approaches would best elucidate SLFN12L's role in gastric cancer progression?

To thoroughly investigate SLFN12L's role in gastric cancer progression during Helicobacter infection, a comprehensive research strategy should include:

  • Temporal expression profiling: Analyze SLFN12L expression at various stages of Helicobacter-induced gastric carcinogenesis using both in vitro and in vivo models.

  • Functional genomics approaches:

    • CRISPR-Cas9 knockout of SLFN12L in gastric cell lines

    • Inducible expression systems to control SLFN12L levels

    • Point mutations targeting key functional domains

  • Protein interaction mapping:

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling methods (BioID, APEX) to identify transient interactions

    • Yeast two-hybrid screening

  • Nucleic acid interaction studies:

    • CLIP-seq to identify RNA binding targets

    • RNA decay assays to assess potential nuclease activity

    • Structure-function studies of the putative zinc finger domain

  • In vivo models:

    • Transgenic mouse models with altered SLFN12L expression

    • Helicobacter infection models with modulated SLFN12L expression

    • Patient-derived xenografts from gastric cancer patients

Could SLFN12L potentially form functional complexes similar to the PDE3A-SLFN12 complex?

Given the structural similarities between SLFN12L and SLFN12, an intriguing research question is whether SLFN12L might form functional complexes with specific partners that enhance or modify its activity, similar to the PDE3A-SLFN12 interaction.

The PDE3A-SLFN12 complex offers a valuable model for investigation. This complex:

  • Forms a heterotetramer with a "butterfly-like shape" when bound with molecular glues such as anagrelide, nauclefine, or DNMDP .

  • Requires the M-domain of SLFN12 for binding to PDE3A .

  • Exhibits enhanced RNase activity when formed, contributing to DNMDP-induced cancer cell death .

  • Is stabilized by molecular glues that bind to PDE3A's enzymatic pocket, creating a modified interface that binds to SLFN12 .

Research strategies to investigate potential SLFN12L complexes should include:

  • Proteomics analyses to identify proteins that co-purify with SLFN12L

  • Structural studies (cryo-EM or X-ray crystallography) to visualize any complexes formed

  • Screening for small molecules that might enhance or disrupt potential SLFN12L protein-protein interactions

  • Comparative analyses of the M-domains of SLFN12 and SLFN12L to identify similarities and differences that might affect partner binding

Such studies could potentially reveal novel therapeutic approaches targeting SLFN12L-containing complexes in gastric cancer or other disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.