Recombinant Pongo abelii Secretory carrier-associated membrane protein 4 (SCAMP4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we can accommodate specific format requirements. Please indicate your desired format when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
While the tag type is determined during production, we can accommodate specific tag requirements. Please specify your preferred tag type, and we will prioritize its development.
Synonyms
SCAMP4; Secretory carrier-associated membrane protein 4; Secretory carrier membrane protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
SCAMP4
Target Protein Sequence
MSEKENNFPPLPKFIPVKPCFYQNFSDEIPVEHQVLVKRIYRLWMFYCATLGVNLIACLA WWIGGGSGTNFGLAFVWLLLFTPCSYVCWFRPVYKAFRADSSFNFMAFFFIFGAQFVLTV IQAIGFSGWGACGWLSAIGFFQYSPGAAVVMLLPAIMFSVSAAMMAIAIMKVHRIYRGAG GSFQKAQTEWNTGTWRNPPSREAQYNNFSGNSLPEYPTVPSYPGSGQWP
Uniprot No.

Target Background

Function
SCAMP4 (Secretory carrier-associated membrane protein 4) is likely involved in membrane protein trafficking.
Database Links
Protein Families
SCAMP family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does Pongo abelii SCAMP4 compare to human SCAMP4 in structure and function?

While both proteins belong to the same family and share considerable sequence homology, species-specific differences exist that may influence experimental outcomes. Research shows that SCAMP4 function appears to be evolutionarily conserved in regulating secretory pathways across different primates.

The following table compares key features between Pongo abelii and human SCAMP4:

FeaturePongo abelii SCAMP4Human SCAMP4
Amino Acid Length229229
Key Functional DomainsTransmembrane domainsTransmembrane domains
Role in SenescencePresumed similar to humanEnhances SASP factor secretion
Ubiquitination SitesPredicted on lysine residuesConfirmed on Lys4 and Lys185
Cellular LocalizationPlasma membranePlasma membrane

When designing experiments, researchers should consider these similarities and differences, especially when extrapolating findings across species.

What is the role of SCAMP4 in cellular senescence and the SASP?

SCAMP4 plays a crucial role in cellular senescence by enhancing the secretion of senescence-associated secretory phenotype (SASP) factors. Research has demonstrated that SCAMP4 is highly abundant on the surface of senescent cells compared to proliferating cells .

The mechanism involves:

  • Stabilization of SCAMP4 protein in senescent cells compared to proliferating cells

  • Accumulation of SCAMP4 on the cell surface of senescent cells

  • Enhancement of SASP factor secretion, including cytokines and growth factors

Experimental evidence shows that silencing SCAMP4 in senescent fibroblasts reduces the secretion of various SASP factors, including interleukin 6 (IL6), IL8, growth differentiation factor 15 (GDF-15), C-X-C motif chemokine ligand 1 (CXCL1), and IL7 . Conversely, overexpression of SCAMP4 in proliferating fibroblasts increases SASP factor secretion, suggesting a direct role in promoting the senescent secretome .

How is SCAMP4 protein regulated differently between proliferating and senescent cells?

SCAMP4 regulation differs significantly between proliferating and senescent cells at the post-translational level. The key regulatory differences include:

  • Protein Stability: SCAMP4 has a short half-life (approximately 1.5 hours) in proliferating cells but is highly stable in senescent cells .

  • Ubiquitin-Proteasome Degradation: In proliferating cells, SCAMP4 is rapidly degraded through the ubiquitin-proteasome system (UPS). Treatment with the proteasome inhibitor MG132 leads to accumulation of SCAMP4 in proliferating cells but not in senescent cells .

  • Ubiquitination: SCAMP4 is ubiquitinated on specific lysine residues (Lys4 and Lys185) in proliferating cells, marking it for proteasomal degradation .

  • Transcriptional Regulation: Interestingly, SCAMP4 mRNA levels do not change significantly between proliferating and senescent cells, indicating that the differences in protein levels are primarily due to post-translational regulation .

This differential regulation results in accumulation of SCAMP4 in senescent cells, where it contributes to the SASP phenotype, while maintaining low levels in proliferating cells.

What techniques are recommended for detecting and quantifying SCAMP4 expression?

Several complementary techniques can be employed for detecting and quantifying SCAMP4 expression in experimental systems:

  • Western Blot Analysis:

    • Most reliable for quantifying relative protein levels

    • Use specific anti-SCAMP4 antibodies

    • Include appropriate controls (e.g., ACTB as loading control)

    • Recommended for comparative studies between proliferating and senescent cells

  • RT-qPCR:

    • For measuring SCAMP4 mRNA expression

    • Use gene-specific primers

    • Include stable reference genes (e.g., GAPDH, ACTB)

    • Note that mRNA levels may not correlate with protein abundance due to post-translational regulation

  • Immunofluorescence Microscopy:

    • For visualizing subcellular localization

    • Can confirm plasma membrane localization

    • Useful for co-localization studies with other secretory pathway markers

  • Flow Cytometry:

    • For quantifying cell surface expression

    • Particularly useful for heterogeneous cell populations

    • Can be combined with senescence markers

  • ELISA:

    • For quantifying recombinant protein in purified preparations

    • Can be used to determine concentration in experimental solutions

Each method provides complementary information, and combining multiple approaches is recommended for comprehensive analysis.

What experimental approaches are effective for studying SCAMP4's impact on SASP factor secretion?

To investigate SCAMP4's role in SASP factor secretion, the following experimental approaches have proven effective:

  • Gene Silencing:

    • Use siRNA or shRNA targeting SCAMP4

    • Confirm knockdown efficiency by Western blot

    • Measure secretion of SASP factors (IL6, IL8, GDF-15, etc.) by ELISA

    • Include appropriate negative controls (scrambled siRNA)

  • Overexpression Studies:

    • Express tagged SCAMP4 (e.g., SCAMP4-Myc) in proliferating cells

    • Confirm expression by Western blot

    • Assess impact on SASP factor secretion by ELISA

    • Monitor potential induction of senescence phenotypes

  • Pharmacological Intervention:

    • Use proteasome inhibitors (e.g., MG132) to stabilize SCAMP4

    • Monitor effects on SASP factor secretion

    • Include time-course analysis to distinguish direct effects from secondary senescence induction

  • Senescence Models:

    • Use multiple senescence induction methods:

      • Ionizing radiation (IR)

      • Doxorubicin treatment

      • Oncogene-induced senescence

      • Replicative senescence

    • Compare SCAMP4 expression and function across models

  • Secretome Analysis:

    • Collect conditioned media from cells with modified SCAMP4 expression

    • Analyze using multiplex ELISA or mass spectrometry

    • Quantify changes in specific SASP factors

These approaches provide complementary data on SCAMP4's role in regulating the senescent secretome.

How can SCAMP4 be used as a marker for cellular senescence?

SCAMP4 presents promising potential as a marker for cellular senescence due to its specific accumulation in senescent cells. The following methodological approaches can leverage SCAMP4 for senescence detection:

  • Cell Surface Detection:

    • Flow cytometry using anti-SCAMP4 antibodies

    • Surface biotinylation followed by Western blot

    • Immunofluorescence microscopy of non-permeabilized cells

  • Comparative Marker Panel:

    • Combine SCAMP4 detection with established senescence markers:

      • SA-β-galactosidase activity

      • p16 and p21 expression

      • SASP factor secretion

      • DPP4 expression (another senescence-associated surface protein)

  • Quantitative Assessment:

    • Establish threshold values for SCAMP4 positivity

    • Develop fluorescence-based intensity scoring systems

    • Use image analysis software for objective quantification

  • In vivo Detection:

    • Develop tagged antibodies for tissue imaging

    • Optimize immunohistochemistry protocols for various tissues

    • Correlate with age-related pathologies

The advantage of SCAMP4 as a senescence marker lies in its cell surface localization, making it accessible for non-invasive detection methods and potential targeting strategies for senolytic approaches.

What experimental contradictions exist in SCAMP4 research and how should they be addressed?

Several experimental contradictions and challenges exist in SCAMP4 research that warrant careful consideration:

  • Varied Effects Across Cell Types:

    • SCAMP4 may have differential effects in different cell types

    • Recommendation: Systematically compare SCAMP4 function across multiple cell types (fibroblasts, endothelial cells, epithelial cells) using identical experimental conditions

  • Senescence Model Variation:

    • SCAMP4 regulation may differ between senescence models

    • Recommendation: Compare SCAMP4 expression and function across diverse senescence models (replicative, stress-induced, oncogene-induced) within the same cellular background

  • Direct vs. Indirect Effects on SASP:

    • Whether SCAMP4 directly mediates secretion or acts through other mechanisms remains unclear

    • Recommendation: Perform acute manipulation of SCAMP4 and analyze immediate effects on secretory pathways before secondary senescence induction occurs

  • Species-Specific Differences:

    • Functional differences between human and Pongo abelii SCAMP4 may exist

    • Recommendation: Conduct comparative studies with SCAMP4 from different species in the same cellular background

  • Technical Limitations in Detection:

    • Antibody specificity issues may confound results

    • Recommendation: Validate antibodies against SCAMP4-knockout controls and use multiple detection methods

Addressing these contradictions requires rigorous experimental design with appropriate controls, replication across multiple experimental systems, and careful interpretation of results considering the specific experimental context.

What are the optimal storage and handling conditions for recombinant Pongo abelii SCAMP4?

Proper storage and handling of recombinant Pongo abelii SCAMP4 is critical for maintaining protein stability and functionality in experimental applications:

Storage Conditions:

  • Store at -20°C for routine usage

  • For extended storage, conserve at -80°C

  • Maintain in Tris-based buffer with 50% glycerol optimized for protein stability

  • Avoid repeated freeze-thaw cycles

Handling Recommendations:

  • Prepare working aliquots and store at 4°C for up to one week

  • Thaw frozen aliquots on ice to minimize protein denaturation

  • Centrifuge briefly after thawing to collect contents

  • Use clean, RNase/DNase-free tubes for aliquoting

Quality Control Considerations:

  • Verify protein integrity by SDS-PAGE before experimental use

  • Check functionality using appropriate activity assays

  • Monitor for aggregation or precipitation

  • Consider including protease inhibitors when using in cellular extracts

Following these guidelines will help ensure experimental reproducibility and reliable results when working with recombinant Pongo abelii SCAMP4.

What experimental controls should be included when studying SCAMP4 function?

Robust experimental design for studying SCAMP4 function requires appropriate controls to ensure valid and interpretable results:

  • Positive Controls:

    • Known SASP inducers (e.g., ionizing radiation, doxorubicin)

    • Established senescence markers (SA-β-gal activity, p16/p21 expression)

    • Validated SASP factors (IL6, IL8, GDF-15)

  • Negative Controls:

    • Proliferating cells without senescence induction

    • Non-targeting siRNA/shRNA for knockdown experiments

    • Empty vector controls for overexpression studies

    • Age-matched healthy tissues for in vivo studies

  • Specificity Controls:

    • SCAMP4 knockout/knockdown validation

    • Rescue experiments with wild-type SCAMP4

    • Related SCAMP family members (SCAMP1-3, 5) to assess specificity

  • Technical Controls:

    • Loading controls for Western blots (ACTB, GAPDH)

    • Normalization to cell number for secretion studies

    • Time-course experiments to distinguish direct from secondary effects

    • Multiple detection methods to confirm key findings

  • Experimental Validation Approaches:

    • Replicate findings in multiple cell types

    • Use different senescence induction methods

    • Apply both gain-of-function and loss-of-function approaches

    • Confirm in vivo relevance when possible

What are promising research avenues for understanding SCAMP4's role in aging and age-related diseases?

Several promising research directions could advance our understanding of SCAMP4's role in aging and age-related diseases:

  • Mechanistic Studies:

    • Investigate the detailed molecular mechanisms by which SCAMP4 enhances SASP factor secretion

    • Identify binding partners and regulatory factors controlling SCAMP4 stability

    • Elucidate the structural basis for SCAMP4's role in secretory pathways

  • Translational Applications:

    • Develop targeted approaches to modulate SCAMP4 function for potential senolytic therapies

    • Explore SCAMP4 as a biomarker for cellular senescence in tissues

    • Investigate correlations between SCAMP4 levels and age-related pathologies

  • Comparative Studies:

    • Analyze SCAMP4 function across different primate species

    • Investigate SCAMP4's role in different tissues and cell types

    • Examine potential tissue-specific regulation of SCAMP4 during aging

  • Systems Biology Approaches:

    • Integrate SCAMP4 into broader senescence regulatory networks

    • Perform multi-omics analysis to understand SCAMP4's impact on cellular physiology

    • Model SCAMP4's contribution to propagation of senescence

  • Therapeutic Targeting:

    • Develop small molecules or biologics that modulate SCAMP4 stability or function

    • Investigate SCAMP4 as an accessible cell surface target for senolytic approaches

    • Explore interventions that restore normal SCAMP4 regulation in age-related disease contexts

These research directions build upon current knowledge that SCAMP4 enhances the senescent cell secretome and could provide insights into aging mechanisms while potentially identifying new therapeutic targets for age-related diseases.

What gene-based analysis approaches can be used to study SCAMP4 in relation to BMI and metabolic traits?

Advanced gene-based analyses offer powerful approaches to investigate SCAMP4's potential connections to BMI and metabolic traits:

  • VEGAS Method Application:

    • Apply the VEGAS (Versatile Gene-based Association Study) algorithm to examine SCAMP4 associations

    • Account for linkage disequilibrium using HapMap LD structures

    • Calculate gene-based test statistics as the sum of all χ²-converted SNP P-values

    • Use Monte Carlo simulation for null distribution calculation

  • Meta-Analysis Strategies:

    • Implement Fisher's method for meta-analysis across multiple cohorts

    • Transform P-values using χ² distribution for proper integration

    • Adjust for cohort-specific covariates such as age, age² and population stratification

  • Pathway Analysis Integration:

    • Utilize ConsensusPathDB for enrichment analysis

    • Calculate Q-values from corrected P-values using FDR from hypergeometric distribution

    • Apply Ingenuity Pathway Analysis to visualize and analyze gene-based results

    • Set confidence filters to consider only experimentally observed relationships

  • Expression Analysis in Metabolic Tissues:

    • Conduct differential expression analysis between cases and controls

    • Rank genes according to P-value significance

    • Scale rankings to ensure comparable distributions across datasets

    • Generate permuted gene ranks to establish null distributions for statistical testing

  • Gene Length Considerations:

    • Account for gene length biases in association analyses

    • Extract and incorporate gene length information from UCSC Genome Browser

    • Sort genes based on significance while considering length as a potential confounder

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.