Recombinant Pongo abelii Signal peptidase complex subunit 1 (SPCS1)

Shipped with Ice Packs
In Stock

Description

Role in Viral Protein Processing

SPCS1 is essential for the replication of flaviviruses (e.g., Zika, Dengue, West Nile) and hepatitis C virus (HCV):

  • Flavivirus Dependency: SPCS1 facilitates cleavage of the prM and E proteins, enabling virion secretion. Loss of SPCS1 reduces flavivirus yields but does not affect host protein secretion .

  • HCV Assembly: SPCS1 interacts with HCV NS2 and E2 proteins, stabilizing the NS2-E2 complex critical for virion assembly .

  • JEV Replication: In Japanese encephalitis virus (JEV), SPCS1 binds NS2B, aiding posttranslational processing and assembly .

Regulation of Signal Peptidase Activity

In yeast, the homolog Spc1 regulates signal peptidase (SPase) substrate specificity:

  • Protection of Transmembrane Segments: Spc1 prevents SPase from cleaving signal-anchored or transmembrane domains, ensuring proper protein targeting .

  • Enhanced Cleavage in Spc1-Deficient Cells: Absence of Spc1 increases SPase activity toward internal signal sequences, altering membrane protein topology .

Host Protein Interactions

  • Limited Impact on Host Proteins: SPCS1 knockout minimally affects surface expression of most host proteins (e.g., CD49d/CD29, HLA-E) .

  • Secretome Analysis: Mass spectrometry reveals only 35 host secreted proteins are downregulated in SPCS1-deficient cells, with fold-changes <2 .

Key Applications in Research

  1. Viral Replication Studies:

    • Validate SPCS1’s role in flavivirus prM/E cleavage and HCV/JEV assembly .

    • Use CRISPR/Cas9 or RNAi to knock down SPCS1 and assess viral yields .

  2. Biochemical Assays:

    • Co-Immunoprecipitation (Co-IP): Identify SPCS1 interactions with viral proteins (e.g., NS2, E2) .

    • Pulse-Chase Experiments: Track prM/E processing defects in SPCS1-deficient cells .

  3. Structural Studies:

    • Analyze SPCS1’s interactions with signal peptides or transmembrane domains using tagged recombinant proteins .

Comparative Analysis of SPCS1 Across Viruses

VirusSPCS1 DependencyMechanism
FlavivirusesEssential for prM/E cleavage and secretionSPCS1-deficient cells show uncleaved prM/E
HCVRequired for NS2-E2 complex formationSPCS1 interacts with NS2 and E2
JEVCritical for NS2B-SPCS1 interactionNS2B transmembrane domains bind SPCS1

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
SPCS1; Signal peptidase complex subunit 1; Microsomal signal peptidase 12 kDa subunit; SPase 12 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
SPCS1
Target Protein Sequence
MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSC LLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN
Uniprot No.

Target Background

Function
Signal peptidase complex subunit 1 (SPCS1) is a component of the microsomal signal peptidase complex. This complex plays a crucial role in removing signal peptides from newly synthesized proteins during their translocation into the lumen of the endoplasmic reticulum.
Database Links
Protein Families
SPCS1 family
Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SPCS1 and what is its primary cellular function?

SPCS1 is a component of the microsomal signal peptidase complex (SPC) that is responsible for the cleavage of signal peptides of many secreted and membrane-associated proteins . This processing is essential for proper protein trafficking and localization within the cell. The signal peptidase complex in eukaryotes comprises four evolutionarily conserved membrane subunits (Spc1-3 and Sec11), with SPCS1 being one of these critical components . The proper functioning of this complex is fundamental to the secretory pathway and affects numerous cellular processes that depend on correctly processed proteins.

What structural domains characterize SPCS1?

SPCS1 contains multiple transmembrane domains that are critical for its function. Research has demonstrated that the region spanning amino acids 91-169 of SPCS1, which contains two transmembrane domains, is particularly important for protein-protein interactions . These transmembrane regions enable SPCS1 to be properly embedded in the endoplasmic reticulum membrane, where it functions as part of the signal peptidase complex. The structural arrangement of these domains facilitates specific interactions with both host and viral proteins during normal cellular processes and viral infections.

How conserved is SPCS1 across species?

SPCS1 is highly conserved across various eukaryotic species, indicating its fundamental importance in cellular function. While the search results don't provide specific sequence homology data between Pongo abelii (Sumatran orangutan) SPCS1 and other species, the high conservation of signal peptidase complex components suggests significant structural and functional similarities. This conservation makes recombinant Pongo abelii SPCS1 a relevant model for studying the protein's function in various experimental contexts, including comparative studies with human SPCS1.

How does SPCS1 regulate flavivirus replication?

SPCS1 has been identified as a crucial host factor for flavivirus replication. In Japanese encephalitis virus (JEV) infection, SPCS1 interacts with the viral nonstructural protein 2B (NS2B) . This interaction influences the posttranslational processing of JEV proteins and the assembly of virions. Studies have shown that two transmembrane domains of JEV NS2B (NS2B(1-49) and NS2B(84-131)) interact with SPCS1, and specific mutations in these domains (G12A, G37A, G47A in NS2B(1-49) and P112A in NS2B(84-131)) weaken this interaction . The loss of SPCS1 function markedly reduces intracellular virion assembly and the production of infectious JEV particles, demonstrating its importance in viral replication .

What is SPCS1's role in Hepatitis C Virus (HCV) replication?

For HCV, SPCS1 has been identified as a host factor participating in virus assembly through interactions with viral proteins E2 and NS2 . Recent studies have shown that SPCS1 specifically facilitates the signal peptidase complex-mediated processing of the HCV E2-p7 junction . This processing is critical for proper viral assembly. Interestingly, loss of SPCS1 impairs the HCV E2-p7 processing by the signal peptidase complex, but it does not affect other processing sites within the HCV polyprotein . Research has demonstrated that both genotype 1a (H77) and genotype 2a (JFH1) HCV strains utilize SPCS1 to facilitate E2-p7 processing during viral replication .

How does SPCS1 loss affect different stages of the viral life cycle?

The loss of SPCS1 function has stage-specific effects on viral replication. For JEV, knocking down or knocking out endogenous SPCS1 markedly reduces intracellular virion assembly and the production of infectious particles, but does not affect cell entry, RNA replication, or translation of the virus . This indicates that SPCS1 primarily functions at the post-translational processing and assembly stages of the viral life cycle. Similarly, for HCV, SPCS1 is specifically involved in viral assembly through its role in E2-p7 processing, rather than affecting viral entry or genome replication . These findings highlight SPCS1's specialized role in viral protein processing and assembly.

What methods are effective for studying SPCS1's role in protein processing?

Several experimental approaches have proven effective for studying SPCS1's role in protein processing:

  • Genetic Manipulation: Knocking down (using siRNA) or knocking out (using CRISPR-Cas9) endogenous SPCS1 can reveal its functional importance . This approach has been successful in demonstrating SPCS1's role in viral protein processing.

  • Complementation Experiments: Co-transfecting SPCS1-expressing plasmids into SPCS1-deficient cells can confirm specific effects attributed to SPCS1 loss. For example, researchers have shown that expressing SPCS1 in knockout cells restores E2-p7 processing for HCV proteins .

  • Protein-Protein Interaction Studies: Techniques such as co-immunoprecipitation and deletion mutation analysis have been used to map interaction domains between SPCS1 and viral proteins like NS2B .

  • Western Blot Analysis: This technique has been effective for assessing the processing of viral polyproteins in the presence or absence of SPCS1, allowing researchers to quantify the relative percentages of processed versus unprocessed proteins .

How can researchers design effective SPCS1 knockout or knockdown experiments?

When designing SPCS1 knockout or knockdown experiments, researchers should consider:

  • Cell Line Selection: Choose cell lines that support the biological process being studied (e.g., virus replication) and express endogenous SPCS1 at detectable levels.

  • Validation of SPCS1 Depletion: Confirm successful reduction of SPCS1 at both mRNA and protein levels using RT-qPCR and western blotting.

  • Rescue Experiments: Include complementation with exogenous SPCS1 to confirm phenotypes are specifically due to SPCS1 depletion rather than off-target effects .

  • Specific Readouts: Develop clear readouts for the process being studied. For viral studies, this might include virus particle production, viral RNA levels, or specific protein processing events .

  • Time-Course Analysis: For dynamic processes like viral infection, analyze effects at multiple time points to distinguish between primary and secondary effects of SPCS1 depletion .

What approaches can be used to study SPCS1 protein-protein interactions?

Several methodological approaches have proven valuable for studying SPCS1's protein-protein interactions:

  • Serial Deletion Mutation Analysis: This approach has been successfully used to identify specific domains of proteins that interact with SPCS1. For example, deletion mutation of JEV NS2B revealed that two transmembrane domains (NS2B(1-49) and NS2B(84-131)) interact with SPCS1 .

  • Site-Directed Mutagenesis: Targeted mutation of conserved residues can identify specific amino acids critical for protein-protein interactions. For JEV NS2B, mutations G12A, G37A, G47A in NS2B(1-49) and P112A in NS2B(84-131) were found to weaken interaction with SPCS1 .

  • Co-Immunoprecipitation: This technique can confirm direct interactions between SPCS1 and potential binding partners under physiological conditions.

  • Fluorescence Resonance Energy Transfer (FRET): While not explicitly mentioned in the search results, FRET could be valuable for studying SPCS1 interactions in living cells.

  • Structural Modeling: Molecular dynamics simulations, similar to those used for studying the yeast SPC AlphaFold2-Multimer model, could provide insights into how SPCS1 interacts with binding partners within the signal peptidase complex .

What is the molecular mechanism by which SPCS1 facilitates HCV E2-p7 processing?

The molecular mechanism of SPCS1-facilitated HCV E2-p7 processing involves enhancing the presentation of the E2-p7 junction to the signal peptidase complex (SPC) active site . Structural modeling suggests that the E2-p7 processing is naturally delayed due to the structural rigidity of the p7 N-terminal transmembrane helix-1 (p7/TM1/helix-1), which tends to remain embedded in the membrane during molecular dynamics simulations .

Mutations that impair E2-p7 processing were found to narrow the p7/TM1/helix-1 bending angle against the membrane, resulting in closer membrane embedment of this helix and reduced access of the E2-p7 junction substrate to the SPC catalytic site, which is located above the membrane in the ER lumen .

The proposed mechanism suggests that SPCS1 enhances E2-p7 processing by facilitating the proper presentation of the E2-p7 junction to the SPC active site, potentially by altering the membrane environment or the conformation of the substrate at the cleavage site .

How does SPCS1 function compare with other signal peptidase complex subunits?

SPCS1 has distinct functions compared to other SPC subunits. While SPCS1 and SPCS3 have been identified as proviral host factors for Flaviviridae family viruses, their specific roles differ . For flaviviruses, SPCS1 specifically facilitates the cleavage of the C-prM junction site .

Research on the yeast homologs provides additional insights. For example, while both Spc1 and Spc2 (yeast homologs) affect signal sequence cleavage, they are not interchangeable, suggesting distinct functions . Experiments showed that overexpression of Spc1 could not complement the cleavage phenotype of Spc2 deletion .

The abundance of catalytic core subunits Sec11 and Spc3 was reduced by approximately 10% in Spc2-deficient yeast cells, yet the signal peptides of certain secretory precursors were still efficiently processed, indicating that the catalytic activity of the SPC per se is at best marginally impaired in the absence of Spc2 . This suggests that SPCS1/Spc2 may function more in substrate recognition and presentation rather than in the catalytic activity itself.

How can structural modeling enhance our understanding of SPCS1 function?

Structural modeling approaches, particularly molecular dynamics simulations, can provide valuable insights into SPCS1 function. For example, simulations of the yeast SPC AlphaFold2-Multimer model indicated that membrane thinning at the center of SPC is reduced without Spc2 (the yeast homolog of SPCS1), suggesting a molecular explanation for the altered substrate recognition properties of SPC lacking Spc2 .

Similar approaches could be applied to study:

  • Membrane Environment Modulation: How SPCS1 influences the local membrane environment to facilitate access of cleavage sites to the SPC active site.

  • Protein-Protein Interaction Interfaces: Predicting and visualizing how SPCS1 interacts with viral proteins like NS2B or E2-p7.

  • Conformational Changes: Understanding how SPCS1 might induce conformational changes in substrate proteins to enhance cleavage efficiency.

  • Species Differences: Modeling differences between human and Pongo abelii SPCS1 could provide insights into structural conservation and functional similarities.

The application of advanced structural biology techniques, combined with computational modeling, represents a promising approach for elucidating the detailed molecular mechanisms of SPCS1 function in normal cellular processes and during viral infections.

What are the potential therapeutic applications of SPCS1 research?

Research on SPCS1 opens potential therapeutic avenues for combating flavivirus infections. Since SPCS1 has been identified as a crucial host factor for multiple flaviviruses including JEV, WNV, DENV, ZIKV, YFV, and HCV , it represents a potential broad-spectrum antiviral target. Unlike virus-directed therapies that may be circumvented by viral mutations, host-directed therapies targeting SPCS1 might provide a higher barrier to resistance.

The specific role of SPCS1 in viral protein processing and assembly, without significantly affecting critical host protein processing , suggests that therapeutic interventions targeting SPCS1-viral protein interactions might be developed with acceptable side effect profiles. Future research should focus on identifying small molecules or peptides that can specifically disrupt these interactions.

What unresolved questions remain regarding SPCS1 function?

Several important questions about SPCS1 remain unanswered:

  • Substrate Specificity Mechanism: How does SPCS1 specifically facilitate the processing of certain viral protein junctions (like C-prM in flaviviruses or E2-p7 in HCV) while having limited impact on other cleavage sites?

  • Regulatory Mechanisms: How is SPCS1 activity regulated during normal cellular function and virus infection?

  • Species-Specific Differences: How do structural and functional differences in SPCS1 across species, including Pongo abelii and humans, affect its role in viral infections?

  • Broader Cellular Functions: Beyond viral infections, what role does SPCS1 play in normal cellular protein processing, particularly for proteins involved in immune responses?

  • Interaction Network: What is the complete network of SPCS1 interactions with both host and viral proteins during infection?

Addressing these questions will require integrated approaches combining structural biology, biochemistry, cell biology, and virology techniques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.