Recombinant Pongo abelii Signal peptidase complex subunit 2 (SPCS2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SPCS2; Signal peptidase complex subunit 2; Microsomal signal peptidase 25 kDa subunit; SPase 25 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-226
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
SPCS2
Target Protein Sequence
AAAAAQGGRSGGIGGCIGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLD DSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISY FVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRT KQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAIERKIK
Uniprot No.

Target Background

Function
A component of the microsomal signal peptidase complex. This complex removes signal peptides from nascent proteins during their translocation into the endoplasmic reticulum lumen.
Database Links
Protein Families
SPCS2 family
Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SPCS2 and what is its primary function in protein processing?

SPCS2 (Signal Peptidase Complex Subunit 2) is an essential component of the signal peptidase complex that catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. It enhances the enzymatic activity of the signal peptidase complex (SPC) and facilitates interactions between different components of the translocation site .

The primary function of SPCS2 involves:

  • Participating in protein targeting to the endoplasmic reticulum

  • Signal peptide processing of secretory and membrane proteins

  • Contributing to membrane protein topology determination

  • Enhancing discrimination between signal peptides (SPs) and signal-anchored sequences (SAs)

What are the optimal storage conditions for recombinant Pongo abelii SPCS2?

For optimal stability and functionality of recombinant Pongo abelii SPCS2:

Storage ParameterRecommended Condition
Short-term storage4°C for up to one week
Long-term storage-20°C or -80°C
Buffer compositionTris-based buffer with 50% glycerol
Freeze-thaw cyclesMinimize; aliquot before freezing

Working aliquots should be stored at 4°C for up to one week, while stock solutions should be kept at -20°C. For extended storage periods, -80°C is recommended. The protein is typically provided in a Tris-based buffer with 50% glycerol optimized for stability .

How should I design experiments to evaluate SPCS2 function in a cell-based system?

When designing experiments to evaluate SPCS2 function:

  • Experimental Design Framework:

    • Use a factorial design approach with controls for all variables

    • Include positive controls (known substrates) and negative controls (non-cleavable sequences)

    • Implement paired observations when possible to reduce variability

  • Key Experimental Variables:

    • SPCS2 expression levels (native, overexpression, knockdown)

    • Signal sequence variations (length of n-region, h-region hydrophobicity)

    • Cell types (relevant to your research question)

    • Time points (immediate vs. long-term effects)

  • Methodology Options:

    • Pulse-chase experiments to capture early stages of protein maturation

    • Fluorescent reporter systems with cleavable signal sequences

    • Mass spectrometry for proteome-wide analysis of signal peptide processing

    • Co-immunoprecipitation to study interactions with translocon components

  • Statistical Considerations:

    • Determine appropriate sample size based on expected effect size

    • Account for biological and technical replicates

    • Use appropriate statistical tests based on your experimental design

What assays can be used to measure SPCS2 activity in vitro?

Several assays can be employed to measure SPCS2 activity:

Assay TypeMethodologyData OutputAdvantages
Fluorogenic peptide cleavageSynthetic peptides with quenched fluorophores that fluoresce upon cleavageFluorescence intensity over timeHigh sensitivity, real-time kinetics
MALDI-TOF analysisMass spectrometry detection of cleaved peptide productsMass peaks of substrate and productsPrecise identification of cleavage sites
Western blotAntibody detection of processed vs. unprocessed proteinsBand size shiftsWorks with native proteins
In vitro translationMicrosomal membranes with reconstituted SPCRadiolabeled protein productsPhysiologically relevant environment

For optimal results, use purified signal peptidase complex containing SPCS2 or reconstituted systems with defined components. Include appropriate controls such as inactive enzyme preparations and non-cleavable substrates .

How does the C-terminal domain of SPCS2 contribute to substrate selection?

The C-terminal domain of SPCS2 plays a critical role in substrate selection through several mechanisms:

  • Structural Contribution:

    • Forms part of the cytosolic portion of the SPC

    • May sterically control access of signal sequences to the TM-window

    • Creates a physical barrier that influences n-region recognition

  • Experimental Evidence:

    • Deletion of the C-terminal 58 or 23 residues results in altered substrate preference

    • SPCS2 without its C-terminal domain shows decreased ability to process signal sequences with short n-regions

    • Conversely, signal sequences with longer n-regions show increased processing in the absence of the C-terminal domain

  • Mechanistic Model:

    • The C-terminal domain likely serves as a "gatekeeper" that preferentially allows signal sequences with shorter n-regions to access the active site

    • This selective mechanism helps discriminate between signal peptides and signal-anchored sequences

    • The domain may interact directly with the n-region of incoming substrates

How does SPCS2 modulate membrane thickness in the SPC transmembrane window, and what are the implications for substrate selectivity?

SPCS2 significantly influences membrane architecture around the SPC, with profound effects on substrate selection:

  • Membrane Modulation Mechanism:

    • SPCS2 contains polar residues (e.g., Tyr79, Ser83) within its transmembrane helices

    • These residues coordinate phosphate headgroups deep within the transmembrane window

    • This coordination causes local membrane thinning at the center of the SPC

    • In SPCS2's absence, membrane thickness increases by approximately 3Å in the transmembrane window

  • Experimental Evidence:

    • Coarse-grained molecular dynamics (CGMD) simulations reveal membrane thinning with SPCS2 present

    • Mutation of polar residues (Y79A, S83A) in SPCS2 reduces membrane thinning

    • Processing of substrates with longer hydrophobic regions increases in SPCS2-depleted cells

  • Functional Implications:

    • Thinned membranes (with SPCS2 present) accommodate shorter hydrophobic regions (h-regions) of signal peptides

    • Signal anchors with longer h-regions are excluded from the active site in thinned membranes

    • The 3Å difference in membrane thickness corresponds to about 2 amino acid residues in an α-helix

    • This provides a physical mechanism for discriminating between signal peptides and signal anchors

  • Research Applications:

    • Manipulating SPCS2 expression or structure can alter the spectrum of processed substrates

    • Designing substrates with specific h-region lengths can target or avoid SPC processing

    • The membrane thickness modulation principle may apply to other membrane protein complexes

What experimental design principles should be applied when investigating potential interactions between SPCS2 and the Sec61 translocon?

When investigating SPCS2-Sec61 interactions, apply these specialized experimental design principles:

  • Spatial and Temporal Considerations:

    • Design experiments capturing the transient nature of these interactions

    • Include time-course studies with appropriate time intervals

    • Account for membrane microdomain effects and lateral diffusion

  • Interaction Capture Methods Matrix:

    MethodApplicationStrengthsLimitationsControls
    FRET/BRETLive cell dynamicsReal-time, in situLow signal-to-noiseDonor/acceptor only
    CrosslinkingTransient interactionsCaptures fleeting contactsPotential artifactsNon-crosslinkable mutants
    Split reporter systemsIn vivo assemblyPhysiological conditionsPotential interferenceFragment-only controls
    Cryo-EMStructural analysisDirect visualizationStatic snapshotsResolution validation
  • Critical Variables to Control:

    • Stoichiometry of SPCS2 to Sec61 components

    • Membrane composition and fluidity

    • Nascent chain occupancy of the translocon

    • Ribosome association status

  • Statistical and Analytical Framework:

    • Use repeated measures designs when possible

    • Implement mixed-effects models to account for batch variations

    • Calculate appropriate sample sizes based on preliminary data

    • Apply correction for multiple comparisons in multi-parameter studies

  • Validation Strategy:

    • Employ orthogonal methods to confirm interactions

    • Use domain mapping to identify specific interaction regions

    • Create separation-of-function mutations that specifically disrupt interactions

    • Correlate interaction data with functional outcomes

How can advanced molecular dynamics simulations be optimized for studying SPCS2 within membrane environments?

Optimizing molecular dynamics simulations for SPCS2 in membranes requires sophisticated parameterization and validation:

  • Model Construction Methodology:

    • Start with AlphaFold2-Multimer predictions for the complete SPC complex

    • Embed in a biologically relevant membrane composition (not just POPC)

    • Include explicit solvent with physiological ion concentrations

    • Model the protein in both apo and substrate-bound states

  • Simulation Parameter Optimization:

    • Begin with coarse-grained simulations (e.g., Martini 3) for equilibration

    • Transition to all-atom simulations using enhanced sampling techniques

    • Implement appropriate force fields (CHARMM36m recommended for membrane proteins)

    • Use physiologically relevant temperature (310K) and pressure (1 atm)

  • Validation Protocol:

    • Compare root mean squared fluctuation (RMSF) between coarse-grained and all-atom simulations

    • Evaluate protein structure confidence through AlphaFold scores for multiple models

    • Calculate root mean squared deviation (RMSD) time series from multiple μs-long simulations

    • Benchmark against experimental structural data when available

  • Analysis Framework:

    • Measure membrane thickness variations across the SPC transmembrane window

    • Track positions of phosphate headgroups relative to the protein complex

    • Identify water penetration into the transmembrane region

    • Calculate free energy profiles for substrate passage through the complex

  • Computational Requirements:

    • Allocate sufficient computational resources (>1000 core-hours per μs)

    • Implement parallelization strategies across multiple nodes

    • Use GPU acceleration where available

    • Consider specialized hardware like Anton systems for longest timescale simulations

What are the considerations for designing experiments to investigate SPCS2's role in disease models, particularly in relation to epiphyseal dysplasia?

When investigating SPCS2's role in disease models such as epiphyseal dysplasia:

  • Model System Selection Matrix:

    Model TypeApplicationsAdvantagesLimitations
    Patient-derived cellsDirect disease relevanceHuman contextLimited availability
    CRISPR-edited cell linesSpecific mutationsIsogenic controlsIn vitro limitations
    Mouse modelsIn vivo physiologyWhole organismSpecies differences
    ZebrafishDevelopment studiesRapid, transparentEvolutionary distance
    Organoids3D tissue contextComplex interactionsTechnical challenges
  • Experimental Design Framework:

    • Implement factorial designs incorporating multiple variables

    • Use paired designs when possible to reduce variability

    • Include longitudinal measurements for developmental phenotypes

    • Incorporate both morphological and molecular endpoints

  • Key Methodological Approaches:

    • Proteomics to identify mis-processed substrates in disease models

    • Imaging of skeletal development in animal models

    • Secretome analysis of patient-derived cells

    • Rescue experiments with wild-type vs. mutant SPCS2

  • Critical Controls and Variables:

    • Rescue with human SPCS2 in non-human models

    • Precise gene dosage effects (heterozygous vs. homozygous)

    • Allele-specific effects of different mutations

    • Developmental timing of interventions

  • Translational Considerations:

    • Correlate cellular phenotypes with clinical presentation

    • Identify potential compensatory mechanisms

    • Develop assays suitable for therapeutic screening

    • Consider tissue-specific effects of SPCS2 dysfunction

What quality control metrics should be applied to recombinant SPCS2 before use in advanced research applications?

For recombinant SPCS2 to yield reliable research results, implement these quality control metrics:

  • Purity Assessment Protocol:

    • SDS-PAGE analysis (target: >90% purity)

    • Mass spectrometry confirmation (intact mass and peptide coverage)

    • Reversed-phase HPLC profile

    • Size exclusion chromatography to assess aggregation state

  • Functional Validation Tests:

    • In vitro signal peptide cleavage assay using known substrates

    • ATPase activity measurement (if applicable)

    • Binding affinity determination for known interacting partners

    • Thermal shift assays for stability assessment

  • Structural Integrity Evaluation:

    • Circular dichroism to confirm secondary structure profile

    • Dynamic light scattering for monodispersity

    • Limited proteolysis patterns

    • Intrinsic fluorescence spectroscopy

  • Contaminant Analysis:

    • Endotoxin testing (especially for E. coli-produced proteins)

    • Host cell protein quantification

    • Residual DNA content

    • Bioactivity assays with inhibitors to confirm specificity

  • Batch-to-Batch Consistency Parameters:

    ParameterAcceptable VariationMethodFrequency
    Protein concentration±10%BCA or Bradford assayEach batch
    Activity±15%Functional assayEach batch
    Molecular weight±0.1%MS analysisRepresentative batches
    Contaminant profileQualitatively similarSDS-PAGEEach batch
    Secondary structure<10% variationCD spectroscopyRepresentative batches
  • Storage Stability Assessment:

    • Activity retention after freeze-thaw cycles

    • Time-course stability at different temperatures

    • Buffer compatibility testing

    • Aggregation propensity monitoring

How can I optimize experimental design for investigating the regulatory relationship between SPCS2 and unfolded protein response (UPR) in the endoplasmic reticulum?

To investigate SPCS2-UPR regulatory relationships:

  • Experimental Design Strategy:

    • Apply a stepwise approach progressing from cell culture to animal models

    • Use time-course experiments to capture UPR dynamics

    • Implement dose-response studies with varying levels of SPCS2 expression

    • Design factorial experiments examining SPCS2 variants × UPR inducers × cell types

  • Key Methodological Approaches:

    • SPCS2 manipulation techniques: siRNA knockdown, CRISPR knockout, overexpression

    • UPR induction methods: chemical inducers (tunicamycin, thapsigargin), physiological stressors

    • Readout systems: UPR reporter constructs, RT-qPCR of UPR genes, Western blotting

    • Proteomics: signal peptide processing efficiency under UPR conditions

  • Critical Variables and Controls:

    • SPCS2 expression/activity levels (quantify precisely)

    • UPR branch specificity (PERK, IRE1, ATF6)

    • Cell type-specific responses

    • Timing of UPR activation relative to SPCS2 manipulation

  • Recommended Analytical Framework:

    Experiment TypeAnalytical ApproachKey MetricsStatistical Method
    Time-courseLongitudinal analysisUPR marker dynamicsMixed-effects models
    Dose-responseSignal-response curvesEC50 valuesNon-linear regression
    Genetic manipulationComparative analysisFold changes in UPR markersANOVA with post-hoc tests
    ProteomicsGlobal protein processingSignal peptide retention ratesFDR-corrected significance
  • Specialized Techniques:

    • Ribosome profiling to assess translational effects

    • Pulse-chase experiments to measure protein maturation kinetics

    • Proximity labeling to identify stress-dependent SPCS2 interactions

    • Single-cell analyses to capture heterogeneity in UPR activation

  • Interpretation Framework:

    • Distinguish direct vs. indirect effects through rescue experiments

    • Assess temporal relationships to establish causality

    • Correlate molecular findings with cellular phenotypes

    • Consider compensatory mechanisms and feedback loops

What are the methodological considerations for comparative studies of SPCS2 function across different primate species?

For cross-species comparative studies of SPCS2:

  • Species Selection Strategy:

    • Include representative species from major primate lineages

    • Consider evolutionary distance and habitat diversity

    • Include both closely related species (e.g., great apes) and more distant relatives

    • Select species with completed genome assemblies when possible

  • Sequence Analysis Framework:

    • Perform multiple sequence alignments with structure-informed gap placement

    • Calculate selective pressure (dN/dS) across domains

    • Identify species-specific insertions, deletions, and substitutions

    • Map variations to functional domains and interaction surfaces

  • Functional Comparison Approaches:

    • Cross-species complementation assays in knockout cell lines

    • Chimeric protein analysis to identify species-specific functional domains

    • Substrate processing efficiency comparisons with identical substrates

    • Interactome analysis using BioID or proximity labeling

  • Structural Biology Considerations:

    • Generate comparative structural models using AlphaFold or similar tools

    • Identify structural differences in substrate binding regions

    • Compare membrane interaction surfaces across species

    • Analyze conservation of post-translational modification sites

  • Experimental Design Recommendations:

    ApproachKey VariablesControlsAnalytical Method
    Heterologous expressionExpression levels, cell typeVector-only, human SPCS2Western blot, RT-qPCR
    Substrate processingSignal sequence variantsKnown efficiently processed substratesPulse-chase, FACS
    Protein-protein interactionsCo-expression conditionsNon-binding mutantsCo-IP, FRET
    Membrane integrationLipid compositionTransmembrane domain swapsCGMD simulation, fluorescence
  • Technical Challenges and Solutions:

    • Codon optimization for expression in heterologous systems

    • Antibody cross-reactivity issues (use epitope tags)

    • Differences in optimal expression conditions (adjust temperature, media)

    • Species-specific post-translational modifications (use mass spectrometry)

How should researchers design experiments to investigate the potential of SPCS2 as a therapeutic target, as suggested by parasite studies?

For investigating SPCS2 as a therapeutic target:

  • Target Validation Experimental Cascade:

    • Begin with genetic knockdown/knockout studies to establish essentiality

    • Progress to chemical inhibition with tool compounds

    • Conduct rescue experiments with inhibitor-resistant mutants

    • Assess on-target effects through proteomics and transcriptomics

  • Selectivity Assessment Framework:

    • Compare inhibitor effects on host vs. parasite/pathogen SPCS2

    • Evaluate cross-reactivity with related proteases

    • Determine cellular toxicity profiles in relevant host cell types

    • Assess effects on global signal peptide processing

  • Phenotypic Screening Design:

    • Develop high-throughput compatible assays for SPCS2 activity

    • Implement physiologically relevant readouts (e.g., parasite viability)

    • Include counter-screens for selectivity

    • Validate hits with orthogonal assays

  • Mechanistic Investigation Approach:

    Experimental TypePurposeMethodologyKey Controls
    Structure-activity relationshipDefine pharmacophoreMedicinal chemistry, binding assaysInactive analogs
    Target engagementConfirm on-target activityCETSA, DARTS, photoaffinity labelingCompetitive binding
    Resistance profilingIdentify mechanismSerial passage, whole-genome sequencingParallel untreated lines
    Systems biologyMap affected pathwaysProteomics, transcriptomics, metabolomicsTime-matched controls
  • In Vivo Evaluation Considerations:

    • Establish PK/PD relationship in animal models

    • Determine effective dosing regimens

    • Assess resistance development potential in vivo

    • Evaluate combination approaches with existing therapies

  • Translational Research Design:

    • Develop biomarkers for target engagement

    • Establish safety margins based on selectivity data

    • Design resistance management strategies

    • Consider indications beyond the initial parasite target

What experimental design considerations are crucial when investigating the evolutionary conservation of SPCS2 function across different organisms?

For evolutionary conservation studies of SPCS2:

  • Taxonomic Sampling Strategy:

    • Include representative species from major eukaryotic lineages

    • Sample deeper within clades of special interest (e.g., primates, model organisms)

    • Consider organisms with unique adaptations (extremophiles, parasites)

    • Include species with varying degrees of protein secretion requirements

  • Sequence-Structure-Function Analysis Framework:

    • Perform phylogenetic analysis with maximum likelihood methods

    • Map conserved residues onto structural models

    • Correlate conservation patterns with functional domains

    • Identify lineage-specific accelerated evolution

  • Functional Complementation Experimental Design:

    • Express SPCS2 orthologs in SPCS2-deficient systems

    • Quantify rescue efficiency using multiple metrics

    • Test processing of conserved and lineage-specific substrates

    • Analyze interaction with conserved SPC components

  • Comparative Biochemistry Approach:

    ParameterMethodologyAnalysisControls
    Substrate specificityIn vitro processing assaysKinetic parameter comparisonConserved substrate panel
    Membrane integrationProtease protection, fluorescenceTopological comparisonChimeric constructs
    Complex assemblyCo-IP, BN-PAGEStoichiometry analysisIndividual components
    Enzyme kineticsActivity assaysKm, kcat, kcat/Km comparisonStandardized conditions
  • Critical Controls and Variables:

    • Expression level normalization across orthologs

    • Codon optimization for heterologous expression

    • Temperature adaptation for enzymes from different thermal environments

    • Membrane composition matching native environments

  • Advanced Analytical Methods:

    • Ancestral sequence reconstruction and resurrection

    • Molecular evolutionary rate analysis

    • Selection pressure calculation across functional domains

    • Correlation of evolutionary patterns with organismal adaptations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.